Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6N6A7

Protein Details
Accession A0A1X6N6A7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-49LIGFRSTEKKLRRRPTRLYRILVTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 8, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences LAQSTWERRGIPWSALSWGLLLGCGLIGFRSTEKKLRRRPTRLYRILVTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.22
4 0.17
5 0.14
6 0.11
7 0.08
8 0.06
9 0.04
10 0.03
11 0.03
12 0.03
13 0.02
14 0.03
15 0.03
16 0.05
17 0.09
18 0.12
19 0.19
20 0.28
21 0.38
22 0.47
23 0.58
24 0.67
25 0.72
26 0.81
27 0.85
28 0.88
29 0.87
30 0.84
31 0.78