Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6MTA9

Protein Details
Accession A0A1X6MTA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-79RVKRTISYTRPQHKQRTVERFIHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MSSDEIIPGDIVAVQNGVSGRREGLVIGSHVDYAGRQILQVQMEPGEIYNAWYPTVTRVKRTISYTRPQHKQRTVERFIYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.08
4 0.09
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.08
11 0.09
12 0.09
13 0.09
14 0.1
15 0.1
16 0.09
17 0.09
18 0.09
19 0.07
20 0.07
21 0.07
22 0.06
23 0.05
24 0.06
25 0.08
26 0.09
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.14
42 0.23
43 0.23
44 0.25
45 0.29
46 0.33
47 0.38
48 0.43
49 0.47
50 0.44
51 0.53
52 0.6
53 0.65
54 0.7
55 0.74
56 0.78
57 0.78
58 0.8
59 0.81
60 0.81
61 0.79