Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X6N8F3

Protein Details
Accession A0A1X6N8F3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
2-24MQQEPRPRVRENKHRPLKCRAAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences SMQQEPRPRVRENKHRPLKCRAAEVGLYTWGDKGRLCALVRAQLVRAQRADAAPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.81
5 0.8
6 0.72
7 0.67
8 0.57
9 0.5
10 0.44
11 0.41
12 0.32
13 0.24
14 0.21
15 0.15
16 0.14
17 0.11
18 0.1
19 0.08
20 0.09
21 0.1
22 0.14
23 0.15
24 0.17
25 0.18
26 0.24
27 0.26
28 0.25
29 0.24
30 0.23
31 0.26
32 0.27
33 0.27
34 0.22
35 0.23
36 0.23