Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6N2R2

Protein Details
Accession A0A1X6N2R2   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
151-170NDDRNKKRDDGKKGDKDVEKBasic
NLS Segment(s)
PositionSequence
123-144KTPKKVAKLVKRGAVKKDVRFK
153-181DRNKKRDDGKKGDKDVEKRGKNVKKETRR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLRHCHLIDLPSTSSASTDGFEEIRTAARVKSDGSVSVREEYHFRRVHSNGRVDEETRTYRVEMRRVDASLEKRAQFTNLTGANTDEDGKVRKVGAAKVDEAKRDDHWVKKPIEVKVNHDSMKTPKKVAKLVKRGAVKKDVRFKNDEGVSNDDRNKKRDDGKKGDKDVEKRGKNVKKETRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.15
4 0.11
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.11
11 0.12
12 0.13
13 0.13
14 0.12
15 0.14
16 0.15
17 0.15
18 0.17
19 0.17
20 0.2
21 0.21
22 0.24
23 0.24
24 0.26
25 0.25
26 0.23
27 0.26
28 0.26
29 0.32
30 0.31
31 0.31
32 0.35
33 0.37
34 0.45
35 0.48
36 0.51
37 0.45
38 0.47
39 0.48
40 0.42
41 0.41
42 0.37
43 0.33
44 0.27
45 0.26
46 0.21
47 0.24
48 0.27
49 0.31
50 0.28
51 0.29
52 0.3
53 0.29
54 0.3
55 0.3
56 0.3
57 0.3
58 0.32
59 0.29
60 0.28
61 0.28
62 0.27
63 0.23
64 0.2
65 0.19
66 0.17
67 0.17
68 0.16
69 0.16
70 0.15
71 0.15
72 0.15
73 0.09
74 0.08
75 0.09
76 0.1
77 0.1
78 0.09
79 0.1
80 0.11
81 0.13
82 0.16
83 0.16
84 0.17
85 0.23
86 0.24
87 0.25
88 0.24
89 0.24
90 0.21
91 0.25
92 0.27
93 0.28
94 0.32
95 0.37
96 0.38
97 0.41
98 0.45
99 0.43
100 0.47
101 0.43
102 0.43
103 0.43
104 0.47
105 0.43
106 0.38
107 0.36
108 0.36
109 0.43
110 0.39
111 0.36
112 0.35
113 0.39
114 0.45
115 0.53
116 0.55
117 0.56
118 0.6
119 0.63
120 0.68
121 0.68
122 0.66
123 0.67
124 0.63
125 0.61
126 0.65
127 0.65
128 0.62
129 0.62
130 0.59
131 0.58
132 0.56
133 0.54
134 0.48
135 0.48
136 0.47
137 0.47
138 0.51
139 0.51
140 0.5
141 0.48
142 0.49
143 0.48
144 0.54
145 0.57
146 0.62
147 0.64
148 0.71
149 0.77
150 0.79
151 0.81
152 0.8
153 0.77
154 0.77
155 0.77
156 0.71
157 0.68
158 0.72
159 0.71
160 0.73
161 0.78