Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X6MPP2

Protein Details
Accession A0A1X6MPP2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-114VTHGRKRKRAGDASSKRRKGKAKARDTWTRWBasic
NLS Segment(s)
PositionSequence
87-108GRKRKRAGDASSKRRKGKAKAR
Subcellular Location(s) nucl 10.5, cyto_nucl 9.833, cyto 8, cyto_mito 7.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MPKRTKVPAALHSELSEYAALLRALRTNDALDLASQLTRASATPAPEDDQMYQDKDGNELDKPLPESAPQEDLVEDVYAMSASVTHGRKRKRAGDASSKRRKGKAKARDTWTRWPLLAGDVHVPEWGLEDEVKLFATTHLCSMSSASDHGHQPLVNDEDDVEDTGLPSSTINVLTSESADHLSRILALLAAHVPPGEKIMQNRVRPLGWEAVLDVVGASGLVDANIVQNVQRRLQTVYGPTSSNVVDRVQTTSSVEMRLDGVCSSHDLSFLTLSGFDPTNSLPKRPTRLSFVTKYLTGQYCSSQYPYCVICFVGGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.24
4 0.15
5 0.12
6 0.13
7 0.12
8 0.11
9 0.12
10 0.14
11 0.15
12 0.17
13 0.18
14 0.16
15 0.17
16 0.18
17 0.17
18 0.13
19 0.14
20 0.13
21 0.12
22 0.11
23 0.1
24 0.09
25 0.09
26 0.09
27 0.12
28 0.13
29 0.15
30 0.17
31 0.2
32 0.22
33 0.23
34 0.25
35 0.22
36 0.23
37 0.23
38 0.23
39 0.23
40 0.23
41 0.22
42 0.21
43 0.22
44 0.2
45 0.18
46 0.19
47 0.19
48 0.19
49 0.21
50 0.2
51 0.19
52 0.19
53 0.21
54 0.2
55 0.22
56 0.19
57 0.18
58 0.16
59 0.16
60 0.15
61 0.12
62 0.09
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.03
69 0.04
70 0.11
71 0.13
72 0.19
73 0.25
74 0.31
75 0.37
76 0.44
77 0.51
78 0.54
79 0.6
80 0.63
81 0.68
82 0.73
83 0.78
84 0.82
85 0.81
86 0.76
87 0.74
88 0.74
89 0.73
90 0.73
91 0.72
92 0.72
93 0.74
94 0.77
95 0.8
96 0.78
97 0.78
98 0.72
99 0.63
100 0.53
101 0.44
102 0.38
103 0.3
104 0.25
105 0.16
106 0.15
107 0.13
108 0.13
109 0.12
110 0.12
111 0.09
112 0.1
113 0.08
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.05
121 0.05
122 0.06
123 0.08
124 0.08
125 0.08
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.07
132 0.08
133 0.08
134 0.1
135 0.1
136 0.11
137 0.11
138 0.11
139 0.1
140 0.12
141 0.13
142 0.11
143 0.1
144 0.09
145 0.09
146 0.09
147 0.09
148 0.07
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.07
163 0.07
164 0.06
165 0.07
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.06
172 0.05
173 0.05
174 0.04
175 0.05
176 0.06
177 0.06
178 0.06
179 0.05
180 0.06
181 0.05
182 0.07
183 0.08
184 0.09
185 0.1
186 0.2
187 0.28
188 0.29
189 0.33
190 0.33
191 0.32
192 0.32
193 0.33
194 0.27
195 0.2
196 0.19
197 0.16
198 0.14
199 0.14
200 0.12
201 0.09
202 0.05
203 0.04
204 0.03
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.03
211 0.03
212 0.04
213 0.04
214 0.05
215 0.1
216 0.13
217 0.15
218 0.17
219 0.18
220 0.21
221 0.23
222 0.26
223 0.25
224 0.28
225 0.27
226 0.27
227 0.25
228 0.25
229 0.23
230 0.2
231 0.18
232 0.14
233 0.13
234 0.13
235 0.16
236 0.15
237 0.15
238 0.16
239 0.18
240 0.19
241 0.19
242 0.18
243 0.15
244 0.16
245 0.15
246 0.14
247 0.11
248 0.1
249 0.09
250 0.11
251 0.13
252 0.12
253 0.12
254 0.12
255 0.13
256 0.13
257 0.12
258 0.11
259 0.09
260 0.09
261 0.11
262 0.11
263 0.1
264 0.11
265 0.12
266 0.21
267 0.23
268 0.25
269 0.28
270 0.35
271 0.43
272 0.48
273 0.51
274 0.5
275 0.57
276 0.63
277 0.62
278 0.61
279 0.58
280 0.52
281 0.5
282 0.49
283 0.44
284 0.38
285 0.35
286 0.32
287 0.31
288 0.32
289 0.34
290 0.29
291 0.26
292 0.28
293 0.28
294 0.26
295 0.24
296 0.21