FuNGI

A0A1X6MX78

Protein Details

Accession

A0A1X6MX78

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
15-37	GAAWYAWQRSQRRKNHVLENLPG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, cyto 6.5, extr 4, cyto_nucl 4, pero 2, cysk 2

Family & Domain DBs

InterPro	View protein in InterPro IPR001128 Cyt_P450 IPR002403 Cyt_P450_E_grp-IV IPR036396 Cyt_P450_sf
Gene Ontology	GO:0020037 F:heme binding GO:0005506 F:iron ion binding GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Pfam	View protein in Pfam PF00067 p450
CDD	cd11069 CYP_FUM15-like

Amino Acid Sequences

MDTLPTVLFLVLAGGAAWYAWQRSQRRKNHVLENLPGPPSRSFLKGSLGEMFHRHAWPFQTDVALNYGPVVKLRGFLNRPIVFVSDPTALHTMIIKEEHIFEESQSFILGNKLIFGPGLLATLGDQHRKQRKILNPVFSVAHMRNMLPLFYDVIYRLRDAISLQVKSGQSEIDILAWTGRVALELIGQSGLGYSFDDFVSDMKDDYGAALKALFPRLMDVDILQRLLPYMPLTVPAGVRRLAISLMPNAAVQKLRSIVDVMSARSVRIFMSKRKALADGDEAVLEQIGKGKDIMSVLMKANELASENDRLSEEELIGQMSTLVFAAVDTTSNTVARILHILSERPHVQDKLRQEILAAGAHNKSSYDELNKLPFLNAVCRETLRLYPIGTTVMRVPNKDTVLPLSEPVVGVDGTIIKEIPIPKGTEVLVGAWACNVKKSLWGEDSTEWKPERWVNGLPTAVLEAPIPGVYSHLMTFLGGKRACIGFKFSEMEMKVLLSVLLSAFTFEPTGRPIIWNLAGVIYPTTSRESETPEMFLKVGLYSEGAKTE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.04
2	0.04
3	0.04
4	0.05
5	0.05
6	0.07
7	0.1
8	0.19
9	0.27
10	0.39
11	0.5
12	0.59
13	0.68
14	0.76
15	0.81
16	0.83
17	0.84
18	0.8
19	0.76
20	0.73
21	0.69
22	0.62
23	0.55
24	0.48
25	0.39
26	0.35
27	0.32
28	0.28
29	0.26
30	0.25
31	0.32
32	0.31
33	0.33
34	0.36
35	0.35
36	0.34
37	0.33
38	0.34
39	0.3
40	0.3
41	0.28
42	0.26
43	0.28
44	0.28
45	0.28
46	0.26
47	0.26
48	0.24
49	0.24
50	0.26
51	0.22
52	0.19
53	0.18
54	0.18
55	0.14
56	0.15
57	0.16
58	0.12
59	0.14
60	0.16
61	0.24
62	0.25
63	0.3
64	0.4
65	0.38
66	0.39
67	0.38
68	0.38
69	0.3
70	0.28
71	0.26
72	0.19
73	0.18
74	0.2
75	0.2
76	0.18
77	0.17
78	0.19
79	0.16
80	0.15
81	0.16
82	0.13
83	0.13
84	0.14
85	0.15
86	0.15
87	0.14
88	0.12
89	0.14
90	0.14
91	0.13
92	0.11
93	0.1
94	0.09
95	0.1
96	0.11
97	0.08
98	0.09
99	0.09
100	0.09
101	0.09
102	0.08
103	0.08
104	0.07
105	0.08
106	0.06
107	0.06
108	0.06
109	0.12
110	0.14
111	0.17
112	0.19
113	0.27
114	0.36
115	0.39
116	0.43
117	0.46
118	0.52
119	0.59
120	0.65
121	0.64
122	0.57
123	0.57
124	0.54
125	0.46
126	0.44
127	0.33
128	0.3
129	0.23
130	0.21
131	0.22
132	0.22
133	0.2
134	0.16
135	0.16
136	0.13
137	0.13
138	0.13
139	0.1
140	0.13
141	0.14
142	0.13
143	0.13
144	0.12
145	0.12
146	0.12
147	0.18
148	0.2
149	0.2
150	0.2
151	0.24
152	0.24
153	0.25
154	0.25
155	0.17
156	0.12
157	0.13
158	0.13
159	0.08
160	0.08
161	0.07
162	0.07
163	0.07
164	0.06
165	0.05
166	0.05
167	0.04
168	0.04
169	0.04
170	0.06
171	0.06
172	0.06
173	0.06
174	0.06
175	0.05
176	0.05
177	0.05
178	0.04
179	0.04
180	0.04
181	0.05
182	0.05
183	0.06
184	0.06
185	0.06
186	0.08
187	0.08
188	0.07
189	0.07
190	0.07
191	0.06
192	0.07
193	0.09
194	0.07
195	0.07
196	0.07
197	0.08
198	0.09
199	0.11
200	0.1
201	0.08
202	0.09
203	0.1
204	0.1
205	0.09
206	0.08
207	0.11
208	0.11
209	0.12
210	0.1
211	0.09
212	0.09
213	0.09
214	0.09
215	0.06
216	0.06
217	0.06
218	0.07
219	0.08
220	0.09
221	0.09
222	0.1
223	0.11
224	0.11
225	0.11
226	0.1
227	0.1
228	0.09
229	0.09
230	0.09
231	0.08
232	0.08
233	0.09
234	0.09
235	0.08
236	0.09
237	0.09
238	0.08
239	0.08
240	0.1
241	0.1
242	0.1
243	0.11
244	0.09
245	0.13
246	0.14
247	0.13
248	0.14
249	0.14
250	0.13
251	0.13
252	0.13
253	0.09
254	0.13
255	0.16
256	0.18
257	0.26
258	0.28
259	0.29
260	0.3
261	0.32
262	0.26
263	0.25
264	0.23
265	0.17
266	0.15
267	0.14
268	0.12
269	0.1
270	0.1
271	0.07
272	0.04
273	0.07
274	0.06
275	0.06
276	0.07
277	0.07
278	0.08
279	0.09
280	0.1
281	0.07
282	0.09
283	0.1
284	0.11
285	0.1
286	0.09
287	0.09
288	0.09
289	0.09
290	0.08
291	0.09
292	0.1
293	0.1
294	0.11
295	0.11
296	0.11
297	0.11
298	0.11
299	0.09
300	0.07
301	0.08
302	0.07
303	0.07
304	0.06
305	0.05
306	0.04
307	0.04
308	0.03
309	0.03
310	0.03
311	0.03
312	0.04
313	0.03
314	0.04
315	0.04
316	0.05
317	0.06
318	0.06
319	0.07
320	0.07
321	0.07
322	0.07
323	0.08
324	0.07
325	0.1
326	0.1
327	0.12
328	0.13
329	0.17
330	0.18
331	0.19
332	0.22
333	0.21
334	0.22
335	0.26
336	0.3
337	0.33
338	0.33
339	0.3
340	0.27
341	0.27
342	0.27
343	0.23
344	0.19
345	0.13
346	0.13
347	0.13
348	0.13
349	0.11
350	0.1
351	0.1
352	0.12
353	0.14
354	0.17
355	0.19
356	0.23
357	0.23
358	0.23
359	0.21
360	0.21
361	0.18
362	0.2
363	0.21
364	0.19
365	0.19
366	0.19
367	0.21
368	0.21
369	0.21
370	0.19
371	0.17
372	0.16
373	0.15
374	0.16
375	0.17
376	0.15
377	0.15
378	0.16
379	0.22
380	0.23
381	0.23
382	0.26
383	0.28
384	0.3
385	0.3
386	0.27
387	0.22
388	0.24
389	0.24
390	0.22
391	0.18
392	0.17
393	0.16
394	0.15
395	0.13
396	0.09
397	0.08
398	0.08
399	0.07
400	0.07
401	0.07
402	0.07
403	0.06
404	0.09
405	0.11
406	0.14
407	0.15
408	0.16
409	0.16
410	0.19
411	0.19
412	0.18
413	0.17
414	0.14
415	0.15
416	0.13
417	0.13
418	0.12
419	0.14
420	0.12
421	0.13
422	0.14
423	0.11
424	0.17
425	0.2
426	0.25
427	0.26
428	0.28
429	0.31
430	0.33
431	0.39
432	0.35
433	0.38
434	0.33
435	0.3
436	0.32
437	0.32
438	0.33
439	0.31
440	0.34
441	0.32
442	0.37
443	0.37
444	0.32
445	0.29
446	0.26
447	0.22
448	0.17
449	0.13
450	0.08
451	0.08
452	0.08
453	0.08
454	0.06
455	0.07
456	0.08
457	0.09
458	0.09
459	0.09
460	0.09
461	0.09
462	0.13
463	0.14
464	0.22
465	0.21
466	0.21
467	0.24
468	0.26
469	0.27
470	0.24
471	0.27
472	0.21
473	0.25
474	0.28
475	0.24
476	0.3
477	0.29
478	0.29
479	0.24
480	0.22
481	0.19
482	0.16
483	0.15
484	0.08
485	0.07
486	0.06
487	0.07
488	0.06
489	0.07
490	0.07
491	0.08
492	0.09
493	0.09
494	0.1
495	0.12
496	0.15
497	0.14
498	0.16
499	0.17
500	0.22
501	0.23
502	0.23
503	0.21
504	0.19
505	0.19
506	0.18
507	0.17
508	0.12
509	0.11
510	0.12
511	0.15
512	0.14
513	0.17
514	0.18
515	0.25
516	0.3
517	0.31
518	0.33
519	0.32
520	0.33
521	0.3
522	0.29
523	0.22
524	0.17
525	0.16
526	0.13
527	0.12
528	0.12

A0A1X6MX78

3D AlphaFold-predicted Structure Viewer