Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BLT5

Protein Details
Accession A0A1Y2BLT5    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-60IYDPSASPSRSRKKRRLETPTPTPTPEHydrophilic
389-414GGAAGGRSRKKGKKGKKVQEPVPAPABasic
NLS Segment(s)
PositionSequence
31-31R
40-49SPSRSRKKRR
393-405GGRSRKKGKKGKK
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024610  ING_N_histone-binding  
Pfam View protein in Pfam  
PF12998  ING  
Amino Acid Sequences MPRKSLPAPSSTPLTSLRSAPATSIKRSRSRKEIYDPSASPSRSRKKRRLETPTPTPTPEPAAGEEAGGDDEADEAEKDLEAWQDFAAEHYEMVEQLPLELHRNFRLLRELDDGCLAQTEKLHALIREYIAYRLPPPTDTSEVIRHEDSGQVEEAQVNGQGEIAQQPSTSNDNLHSTPPSRSGEESLLHSSSNAEEPYETPEPVEYDLHVPLKPSEPSAPETAEEMGVPLPDGHGGLLLPMEPAEPAGDVEPRREFPAAQNTSTQSRSGGKVNGSTDDGKGEVASQIEATAGPSRTQRATKPYLPEIGKLIREVVRNGEEKLAVALGAYNIIDRHIRALDQALDAQEASIVLGLRPSTMPSHSVDPDQEDVAQETEQVQDEGEVTIGLGGAAGGRSRKKGKKGKKVQEPVPAPAAPQLHPSGMPLDFVADPYGYPPTLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.32
4 0.32
5 0.29
6 0.29
7 0.29
8 0.34
9 0.34
10 0.39
11 0.45
12 0.49
13 0.56
14 0.64
15 0.7
16 0.7
17 0.74
18 0.75
19 0.77
20 0.79
21 0.76
22 0.76
23 0.69
24 0.65
25 0.65
26 0.57
27 0.53
28 0.53
29 0.57
30 0.59
31 0.68
32 0.72
33 0.75
34 0.84
35 0.9
36 0.9
37 0.9
38 0.89
39 0.89
40 0.9
41 0.83
42 0.76
43 0.67
44 0.59
45 0.53
46 0.46
47 0.38
48 0.3
49 0.29
50 0.26
51 0.23
52 0.21
53 0.16
54 0.14
55 0.11
56 0.08
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.05
65 0.06
66 0.07
67 0.1
68 0.09
69 0.1
70 0.09
71 0.1
72 0.1
73 0.11
74 0.12
75 0.1
76 0.09
77 0.1
78 0.1
79 0.09
80 0.1
81 0.1
82 0.07
83 0.07
84 0.08
85 0.08
86 0.12
87 0.13
88 0.16
89 0.17
90 0.21
91 0.21
92 0.21
93 0.28
94 0.26
95 0.28
96 0.3
97 0.29
98 0.26
99 0.28
100 0.26
101 0.18
102 0.18
103 0.15
104 0.1
105 0.1
106 0.12
107 0.11
108 0.14
109 0.15
110 0.14
111 0.16
112 0.18
113 0.18
114 0.18
115 0.18
116 0.17
117 0.16
118 0.17
119 0.17
120 0.17
121 0.17
122 0.15
123 0.18
124 0.21
125 0.23
126 0.24
127 0.26
128 0.29
129 0.3
130 0.32
131 0.29
132 0.25
133 0.22
134 0.24
135 0.21
136 0.17
137 0.15
138 0.13
139 0.13
140 0.12
141 0.11
142 0.08
143 0.09
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.07
150 0.08
151 0.07
152 0.07
153 0.07
154 0.09
155 0.12
156 0.12
157 0.11
158 0.12
159 0.16
160 0.17
161 0.18
162 0.18
163 0.17
164 0.18
165 0.23
166 0.23
167 0.21
168 0.21
169 0.22
170 0.22
171 0.22
172 0.23
173 0.21
174 0.19
175 0.18
176 0.16
177 0.14
178 0.12
179 0.13
180 0.1
181 0.07
182 0.07
183 0.08
184 0.14
185 0.15
186 0.14
187 0.12
188 0.12
189 0.13
190 0.14
191 0.14
192 0.09
193 0.09
194 0.11
195 0.12
196 0.12
197 0.12
198 0.11
199 0.14
200 0.13
201 0.13
202 0.13
203 0.14
204 0.16
205 0.17
206 0.17
207 0.15
208 0.15
209 0.14
210 0.12
211 0.1
212 0.08
213 0.06
214 0.06
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.04
234 0.05
235 0.08
236 0.08
237 0.1
238 0.12
239 0.13
240 0.15
241 0.15
242 0.15
243 0.16
244 0.26
245 0.27
246 0.26
247 0.28
248 0.28
249 0.31
250 0.31
251 0.27
252 0.19
253 0.18
254 0.19
255 0.2
256 0.21
257 0.19
258 0.22
259 0.23
260 0.23
261 0.23
262 0.22
263 0.19
264 0.17
265 0.16
266 0.12
267 0.11
268 0.09
269 0.08
270 0.07
271 0.07
272 0.06
273 0.06
274 0.06
275 0.06
276 0.07
277 0.1
278 0.1
279 0.11
280 0.12
281 0.15
282 0.18
283 0.21
284 0.23
285 0.27
286 0.33
287 0.37
288 0.42
289 0.42
290 0.47
291 0.46
292 0.43
293 0.4
294 0.37
295 0.33
296 0.28
297 0.28
298 0.24
299 0.24
300 0.24
301 0.24
302 0.25
303 0.26
304 0.26
305 0.25
306 0.21
307 0.2
308 0.19
309 0.15
310 0.09
311 0.08
312 0.07
313 0.05
314 0.06
315 0.05
316 0.05
317 0.05
318 0.07
319 0.08
320 0.07
321 0.1
322 0.1
323 0.1
324 0.11
325 0.14
326 0.15
327 0.15
328 0.17
329 0.15
330 0.14
331 0.14
332 0.13
333 0.1
334 0.08
335 0.06
336 0.06
337 0.06
338 0.05
339 0.07
340 0.07
341 0.08
342 0.08
343 0.1
344 0.11
345 0.12
346 0.14
347 0.15
348 0.21
349 0.21
350 0.24
351 0.24
352 0.25
353 0.26
354 0.25
355 0.23
356 0.18
357 0.18
358 0.17
359 0.15
360 0.12
361 0.11
362 0.12
363 0.12
364 0.11
365 0.1
366 0.09
367 0.09
368 0.09
369 0.08
370 0.06
371 0.05
372 0.05
373 0.05
374 0.04
375 0.04
376 0.03
377 0.03
378 0.04
379 0.06
380 0.09
381 0.12
382 0.18
383 0.28
384 0.35
385 0.46
386 0.56
387 0.66
388 0.73
389 0.82
390 0.87
391 0.89
392 0.92
393 0.9
394 0.9
395 0.84
396 0.78
397 0.73
398 0.62
399 0.52
400 0.47
401 0.42
402 0.32
403 0.32
404 0.29
405 0.24
406 0.24
407 0.25
408 0.23
409 0.21
410 0.21
411 0.16
412 0.16
413 0.15
414 0.15
415 0.16
416 0.12
417 0.12
418 0.13
419 0.16
420 0.13