Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2B8V3

Protein Details
Accession A0A1Y2B8V3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
30-72EVDPRSGKIKRKERPIPPGLSKRDQKALRKIRRRAHRLDKGMNBasic
NLS Segment(s)
PositionSequence
34-66RSGKIKRKERPIPPGLSKRDQKALRKIRRRAHR
Subcellular Location(s) mito 14, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
Pfam View protein in Pfam  
PF13430  DUF4112  
Amino Acid Sequences MSAIATKAAQKLLKGKASAWAPSDPHYVEEVDPRSGKIKRKERPIPPGLSKRDQKALRKIRRRAHRLDKGMNLCGFRVGYTFFIGIVPGLGDVVDATLNYTLIVKPARKLDIPDELLTKMLFNNAISAGLGLVPVVGDVGLAAWKANSRNAHLLEAYLTIRGQEHLATLGQGPSAITDSTTQGAHPEEVRGVFVPGSGMDGDATHDDEGKGSGGGRWGKNKSKGKNDAVVGNGTGQGGQYGAVAPGSGTGAGKTVGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.4
4 0.42
5 0.43
6 0.38
7 0.36
8 0.32
9 0.34
10 0.38
11 0.31
12 0.3
13 0.28
14 0.26
15 0.22
16 0.28
17 0.27
18 0.26
19 0.26
20 0.26
21 0.3
22 0.34
23 0.41
24 0.44
25 0.52
26 0.55
27 0.65
28 0.74
29 0.77
30 0.82
31 0.82
32 0.8
33 0.8
34 0.82
35 0.78
36 0.77
37 0.73
38 0.67
39 0.68
40 0.67
41 0.65
42 0.67
43 0.7
44 0.72
45 0.77
46 0.82
47 0.81
48 0.85
49 0.85
50 0.84
51 0.84
52 0.83
53 0.81
54 0.79
55 0.79
56 0.72
57 0.69
58 0.62
59 0.51
60 0.41
61 0.35
62 0.28
63 0.19
64 0.16
65 0.12
66 0.1
67 0.11
68 0.11
69 0.09
70 0.09
71 0.09
72 0.08
73 0.06
74 0.05
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.07
90 0.1
91 0.1
92 0.12
93 0.15
94 0.18
95 0.18
96 0.2
97 0.21
98 0.26
99 0.28
100 0.27
101 0.25
102 0.23
103 0.22
104 0.2
105 0.17
106 0.1
107 0.08
108 0.07
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.04
117 0.04
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.01
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.04
132 0.05
133 0.09
134 0.11
135 0.13
136 0.19
137 0.2
138 0.21
139 0.2
140 0.2
141 0.17
142 0.17
143 0.14
144 0.1
145 0.08
146 0.07
147 0.07
148 0.08
149 0.08
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.07
157 0.07
158 0.07
159 0.06
160 0.05
161 0.07
162 0.06
163 0.06
164 0.07
165 0.08
166 0.09
167 0.1
168 0.09
169 0.09
170 0.11
171 0.11
172 0.11
173 0.11
174 0.11
175 0.11
176 0.13
177 0.12
178 0.11
179 0.1
180 0.09
181 0.09
182 0.07
183 0.08
184 0.07
185 0.07
186 0.06
187 0.06
188 0.08
189 0.08
190 0.1
191 0.08
192 0.09
193 0.09
194 0.09
195 0.1
196 0.09
197 0.09
198 0.07
199 0.08
200 0.13
201 0.19
202 0.22
203 0.29
204 0.35
205 0.43
206 0.53
207 0.61
208 0.64
209 0.69
210 0.75
211 0.74
212 0.75
213 0.7
214 0.65
215 0.58
216 0.51
217 0.42
218 0.33
219 0.28
220 0.2
221 0.17
222 0.12
223 0.09
224 0.07
225 0.07
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.05
232 0.06
233 0.07
234 0.07
235 0.07
236 0.07
237 0.08