Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B7D3

Protein Details
Accession A0A1Y2B7D3   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSRSRSMSKSRSRSPVKRAASHydrophilic
NLS Segment(s)
PositionSequence
241-306GRGGFGRDEPAGGGSWRGGAPLRGGHSRRSRSPERETNGHRNGSRRSRSPDDRGARRESWASRRRD
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MSRSRSMSKSRSRSPVKRAASPSAEETTCPFLIRIFLTKGKHTPMLDFDDGKLPLRDEFQVYGWKNWTPTSLIQLLYPSFPPPYRSPFARFSFRHIYVDASQRGLYRSRDLVSFTGRDLLATVVPSDEHPKLDKDAMDMELDDIEAPSKRVGGRKVDEKTLDAYGFVTGDLLSVSLHVPEPKIGAGAGPGPGPRGNTAVTGAPVQSFGWADRDRPPHAGAAPATGGWGRGDPLPPQAARGGRGGFGRDEPAGGGSWRGGAPLRGGHSRRSRSPERETNGHRNGSRRSRSPDDRGARRESWASRRRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.79
4 0.78
5 0.76
6 0.74
7 0.68
8 0.63
9 0.58
10 0.54
11 0.48
12 0.39
13 0.36
14 0.34
15 0.29
16 0.26
17 0.21
18 0.16
19 0.19
20 0.21
21 0.22
22 0.21
23 0.27
24 0.29
25 0.34
26 0.37
27 0.39
28 0.43
29 0.39
30 0.37
31 0.37
32 0.41
33 0.39
34 0.37
35 0.33
36 0.33
37 0.33
38 0.32
39 0.28
40 0.22
41 0.2
42 0.21
43 0.21
44 0.18
45 0.19
46 0.19
47 0.26
48 0.27
49 0.29
50 0.29
51 0.29
52 0.28
53 0.27
54 0.26
55 0.21
56 0.21
57 0.23
58 0.23
59 0.22
60 0.21
61 0.23
62 0.22
63 0.19
64 0.19
65 0.15
66 0.14
67 0.15
68 0.19
69 0.2
70 0.27
71 0.3
72 0.33
73 0.37
74 0.42
75 0.46
76 0.51
77 0.48
78 0.48
79 0.53
80 0.51
81 0.48
82 0.4
83 0.39
84 0.34
85 0.4
86 0.34
87 0.27
88 0.26
89 0.24
90 0.26
91 0.25
92 0.23
93 0.19
94 0.21
95 0.2
96 0.2
97 0.21
98 0.22
99 0.21
100 0.2
101 0.17
102 0.18
103 0.17
104 0.15
105 0.14
106 0.12
107 0.09
108 0.09
109 0.09
110 0.05
111 0.06
112 0.07
113 0.1
114 0.1
115 0.11
116 0.12
117 0.13
118 0.15
119 0.16
120 0.16
121 0.13
122 0.15
123 0.14
124 0.13
125 0.12
126 0.1
127 0.08
128 0.08
129 0.07
130 0.05
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.07
137 0.11
138 0.14
139 0.19
140 0.22
141 0.29
142 0.31
143 0.33
144 0.33
145 0.31
146 0.3
147 0.26
148 0.22
149 0.15
150 0.13
151 0.1
152 0.09
153 0.08
154 0.06
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.06
166 0.06
167 0.07
168 0.06
169 0.07
170 0.06
171 0.05
172 0.06
173 0.06
174 0.07
175 0.07
176 0.07
177 0.08
178 0.09
179 0.1
180 0.1
181 0.11
182 0.11
183 0.11
184 0.12
185 0.12
186 0.12
187 0.12
188 0.11
189 0.09
190 0.09
191 0.09
192 0.08
193 0.08
194 0.07
195 0.13
196 0.13
197 0.15
198 0.22
199 0.27
200 0.28
201 0.3
202 0.31
203 0.27
204 0.27
205 0.29
206 0.22
207 0.2
208 0.18
209 0.15
210 0.14
211 0.12
212 0.12
213 0.08
214 0.08
215 0.07
216 0.09
217 0.11
218 0.11
219 0.15
220 0.19
221 0.18
222 0.19
223 0.23
224 0.23
225 0.23
226 0.25
227 0.23
228 0.21
229 0.22
230 0.22
231 0.2
232 0.19
233 0.2
234 0.17
235 0.16
236 0.14
237 0.14
238 0.13
239 0.11
240 0.11
241 0.08
242 0.1
243 0.09
244 0.1
245 0.1
246 0.1
247 0.12
248 0.15
249 0.19
250 0.26
251 0.28
252 0.35
253 0.44
254 0.5
255 0.55
256 0.6
257 0.65
258 0.65
259 0.73
260 0.74
261 0.72
262 0.75
263 0.76
264 0.78
265 0.76
266 0.76
267 0.69
268 0.66
269 0.68
270 0.69
271 0.69
272 0.66
273 0.67
274 0.7
275 0.75
276 0.77
277 0.78
278 0.77
279 0.79
280 0.77
281 0.76
282 0.68
283 0.64
284 0.63
285 0.6
286 0.61