Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H0EM87

Protein Details
Accession H0EM87    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
112-135KGEQEEKKQKRTVKKESRANIEETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003173  PC4_C  
IPR009044  ssDNA-bd_transcriptional_reg  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02229  PC4  
Amino Acid Sequences MPKRGRGKEVEEYESDGGFVEDDGHEVPKSKKNKKTAVVSKSTGASGSSFWELSSGRTPRRVEITEFKNMKLVNIREFYEKNDEYLPGKKITASLKSSGIEFDETEPAPEIKGEQEEKKQKRTVKKESRANIEETSDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.33
3 0.23
4 0.17
5 0.12
6 0.11
7 0.07
8 0.06
9 0.07
10 0.08
11 0.09
12 0.09
13 0.12
14 0.16
15 0.22
16 0.31
17 0.39
18 0.46
19 0.54
20 0.62
21 0.67
22 0.75
23 0.77
24 0.75
25 0.73
26 0.68
27 0.61
28 0.53
29 0.45
30 0.35
31 0.26
32 0.18
33 0.12
34 0.12
35 0.11
36 0.1
37 0.09
38 0.1
39 0.1
40 0.11
41 0.18
42 0.19
43 0.19
44 0.25
45 0.26
46 0.27
47 0.32
48 0.31
49 0.29
50 0.33
51 0.36
52 0.39
53 0.39
54 0.37
55 0.35
56 0.33
57 0.3
58 0.28
59 0.26
60 0.21
61 0.22
62 0.23
63 0.24
64 0.25
65 0.26
66 0.28
67 0.26
68 0.23
69 0.22
70 0.22
71 0.21
72 0.24
73 0.24
74 0.18
75 0.18
76 0.17
77 0.19
78 0.22
79 0.25
80 0.24
81 0.24
82 0.26
83 0.26
84 0.26
85 0.23
86 0.21
87 0.16
88 0.14
89 0.13
90 0.14
91 0.14
92 0.14
93 0.15
94 0.14
95 0.13
96 0.12
97 0.11
98 0.1
99 0.15
100 0.18
101 0.21
102 0.3
103 0.41
104 0.47
105 0.54
106 0.59
107 0.61
108 0.68
109 0.74
110 0.76
111 0.76
112 0.81
113 0.83
114 0.85
115 0.88
116 0.8
117 0.75
118 0.67
119 0.58
120 0.49