Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B3Z7

Protein Details
Accession A0A1Y2B3Z7   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRSQFAKKARRSSKPAQATSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto_nucl 6.5, nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF13432  TPR_16  
Amino Acid Sequences MGRSQFAKKARRSSKPAQATSSTPTKLPTAEQLIERAHDLLAQSNFQDAIQVLLAALALDENNLEVKELLGVAELEGGDVEQGRQYLLQLFPPHTSATPSQPSPYLYLAQSAEDPTEALKYYTLAVELIESKLSSDKSKNGPSGEEELRQQAVDALVAMIEIWMSDLCMEEGAESQCETLISRALELDPTNPEVRLSLASIRMSQARSDDAKQVVISLYTELQNKEPFDETLPSLPARLHLIRLLLEHEKHLQALEMLTTVREEDELLVEGAYLEGWALYLRAQYLASNPPASIQTTEDGEAQVDGPAGMSAAECLEEASASLFECAKLYTDQDYDDEGIGAHVAELLKELEEKGVKPVRLEEDEDEEAMDGDGAVEGDWEDLEEGGKDVDMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.81
4 0.77
5 0.71
6 0.65
7 0.62
8 0.6
9 0.51
10 0.41
11 0.38
12 0.34
13 0.31
14 0.3
15 0.31
16 0.3
17 0.32
18 0.32
19 0.35
20 0.34
21 0.34
22 0.33
23 0.26
24 0.19
25 0.17
26 0.16
27 0.18
28 0.18
29 0.18
30 0.17
31 0.18
32 0.18
33 0.16
34 0.17
35 0.11
36 0.11
37 0.1
38 0.1
39 0.08
40 0.08
41 0.08
42 0.06
43 0.06
44 0.04
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.07
73 0.11
74 0.12
75 0.16
76 0.18
77 0.2
78 0.21
79 0.22
80 0.23
81 0.19
82 0.22
83 0.2
84 0.24
85 0.27
86 0.27
87 0.27
88 0.28
89 0.29
90 0.28
91 0.28
92 0.24
93 0.19
94 0.21
95 0.2
96 0.19
97 0.18
98 0.16
99 0.14
100 0.11
101 0.11
102 0.08
103 0.09
104 0.08
105 0.08
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.07
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.1
120 0.11
121 0.13
122 0.14
123 0.2
124 0.26
125 0.31
126 0.34
127 0.33
128 0.33
129 0.33
130 0.37
131 0.34
132 0.3
133 0.25
134 0.24
135 0.23
136 0.21
137 0.18
138 0.13
139 0.1
140 0.08
141 0.07
142 0.05
143 0.04
144 0.04
145 0.04
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.03
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.09
175 0.08
176 0.11
177 0.11
178 0.11
179 0.1
180 0.09
181 0.1
182 0.09
183 0.09
184 0.08
185 0.1
186 0.1
187 0.11
188 0.11
189 0.13
190 0.13
191 0.12
192 0.12
193 0.13
194 0.15
195 0.16
196 0.19
197 0.17
198 0.18
199 0.17
200 0.17
201 0.14
202 0.12
203 0.1
204 0.07
205 0.07
206 0.09
207 0.11
208 0.11
209 0.13
210 0.15
211 0.15
212 0.16
213 0.16
214 0.15
215 0.15
216 0.16
217 0.15
218 0.15
219 0.16
220 0.14
221 0.14
222 0.13
223 0.12
224 0.14
225 0.14
226 0.13
227 0.13
228 0.14
229 0.14
230 0.15
231 0.17
232 0.16
233 0.16
234 0.16
235 0.18
236 0.17
237 0.16
238 0.16
239 0.13
240 0.1
241 0.1
242 0.08
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.05
249 0.05
250 0.05
251 0.05
252 0.06
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.06
259 0.05
260 0.04
261 0.03
262 0.02
263 0.02
264 0.03
265 0.03
266 0.03
267 0.04
268 0.05
269 0.06
270 0.06
271 0.07
272 0.1
273 0.15
274 0.16
275 0.17
276 0.16
277 0.17
278 0.18
279 0.19
280 0.17
281 0.14
282 0.14
283 0.15
284 0.16
285 0.15
286 0.14
287 0.13
288 0.12
289 0.11
290 0.09
291 0.07
292 0.06
293 0.06
294 0.05
295 0.05
296 0.05
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.05
304 0.04
305 0.05
306 0.06
307 0.06
308 0.06
309 0.07
310 0.07
311 0.07
312 0.08
313 0.08
314 0.09
315 0.1
316 0.12
317 0.15
318 0.15
319 0.17
320 0.17
321 0.2
322 0.19
323 0.18
324 0.16
325 0.12
326 0.11
327 0.1
328 0.09
329 0.06
330 0.06
331 0.06
332 0.06
333 0.07
334 0.08
335 0.08
336 0.09
337 0.09
338 0.12
339 0.14
340 0.15
341 0.22
342 0.29
343 0.29
344 0.3
345 0.35
346 0.38
347 0.39
348 0.43
349 0.37
350 0.38
351 0.38
352 0.37
353 0.32
354 0.25
355 0.22
356 0.17
357 0.14
358 0.07
359 0.05
360 0.05
361 0.05
362 0.05
363 0.04
364 0.04
365 0.05
366 0.05
367 0.05
368 0.05
369 0.05
370 0.06
371 0.06
372 0.07
373 0.07