Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2B3Z7

Protein Details
Accession A0A1Y2B3Z7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRSQFAKKARRSSKPAQATSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto_nucl 6.5, nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF13432  TPR_16  
Amino Acid Sequences MGRSQFAKKARRSSKPAQATSSTPTKLPTAEQLIERAHDLLAQSNFQDAIQVLLAALALDENNLEVKELLGVAELEGGDVEQGRQYLLQLFPPHTSATPSQPSPYLYLAQSAEDPTEALKYYTLAVELIESKLSSDKSKNGPSGEEELRQQAVDALVAMIEIWMSDLCMEEGAESQCETLISRALELDPTNPEVRLSLASIRMSQARSDDAKQVVISLYTELQNKEPFDETLPSLPARLHLIRLLLEHEKHLQALEMLTTVREEDELLVEGAYLEGWALYLRAQYLASNPPASIQTTEDGEAQVDGPAGMSAAECLEEASASLFECAKLYTDQDYDDEGIGAHVAELLKELEEKGVKPVRLEEDEDEEAMDGDGAVEGDWEDLEEGGKDVDMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.81
4 0.77
5 0.71
6 0.65
7 0.62
8 0.6
9 0.51
10 0.41
11 0.38
12 0.34
13 0.31
14 0.3
15 0.31
16 0.3
17 0.32
18 0.32
19 0.35
20 0.34
21 0.34
22 0.33
23 0.26
24 0.19
25 0.17
26 0.16
27 0.18
28 0.18
29 0.18
30 0.17
31 0.18
32 0.18
33 0.16
34 0.17
35 0.11
36 0.11
37 0.1
38 0.1
39 0.08
40 0.08
41 0.08
42 0.06
43 0.06
44 0.04
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.07
73 0.11
74 0.12
75 0.16
76 0.18
77 0.2
78 0.21
79 0.22
80 0.23
81 0.19
82 0.22
83 0.2
84 0.24
85 0.27
86 0.27
87 0.27
88 0.28
89 0.29
90 0.28
91 0.28
92 0.24
93 0.19
94 0.21
95 0.2
96 0.19
97 0.18
98 0.16
99 0.14
100 0.11
101 0.11
102 0.08
103 0.09
104 0.08
105 0.08
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.07
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.1
120 0.11
121 0.13
122 0.14
123 0.2
124 0.26
125 0.31
126 0.34
127 0.33
128 0.33
129 0.33
130 0.37
131 0.34
132 0.3
133 0.25
134 0.24
135 0.23
136 0.21
137 0.18
138 0.13
139 0.1
140 0.08
141 0.07
142 0.05
143 0.04
144 0.04
145 0.04
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.03
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.08
173 0.08
174 0.09
175 0.08
176 0.11
177 0.11
178 0.11
179 0.1
180 0.09
181 0.1
182 0.09
183 0.09
184 0.08
185 0.1
186 0.1
187 0.11
188 0.11
189 0.13
190 0.13
191 0.12
192 0.12
193 0.13
194 0.15
195 0.16
196 0.19
197 0.17
198 0.18
199 0.17
200 0.17
201 0.14
202 0.12
203 0.1
204 0.07
205 0.07
206 0.09
207 0.11
208 0.11
209 0.13
210 0.15
211 0.15
212 0.16
213 0.16
214 0.15
215 0.15
216 0.16
217 0.15
218 0.15
219 0.16
220 0.14
221 0.14
222 0.13
223 0.12
224 0.14
225 0.14
226 0.13
227 0.13
228 0.14
229 0.14
230 0.15
231 0.17
232 0.16
233 0.16
234 0.16
235 0.18
236 0.17
237 0.16
238 0.16
239 0.13
240 0.1
241 0.1
242 0.08
243 0.06
244 0.06
245 0.06
246 0.06
247 0.06
248 0.05
249 0.05
250 0.05
251 0.05
252 0.06
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.06
259 0.05
260 0.04
261 0.03
262 0.02
263 0.02
264 0.03
265 0.03
266 0.03
267 0.04
268 0.05
269 0.06
270 0.06
271 0.07
272 0.1
273 0.15
274 0.16
275 0.17
276 0.16
277 0.17
278 0.18
279 0.19
280 0.17
281 0.14
282 0.14
283 0.15
284 0.16
285 0.15
286 0.14
287 0.13
288 0.12
289 0.11
290 0.09
291 0.07
292 0.06
293 0.06
294 0.05
295 0.05
296 0.05
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.05
304 0.04
305 0.05
306 0.06
307 0.06
308 0.06
309 0.07
310 0.07
311 0.07
312 0.08
313 0.08
314 0.09
315 0.1
316 0.12
317 0.15
318 0.15
319 0.17
320 0.17
321 0.2
322 0.19
323 0.18
324 0.16
325 0.12
326 0.11
327 0.1
328 0.09
329 0.06
330 0.06
331 0.06
332 0.06
333 0.07
334 0.08
335 0.08
336 0.09
337 0.09
338 0.12
339 0.14
340 0.15
341 0.22
342 0.29
343 0.29
344 0.3
345 0.35
346 0.38
347 0.39
348 0.43
349 0.37
350 0.38
351 0.38
352 0.37
353 0.32
354 0.25
355 0.22
356 0.17
357 0.14
358 0.07
359 0.05
360 0.05
361 0.05
362 0.05
363 0.04
364 0.04
365 0.05
366 0.05
367 0.05
368 0.05
369 0.05
370 0.06
371 0.06
372 0.07
373 0.07