Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ALZ5

Protein Details
Accession A0A1Y2ALZ5   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-47AHIPIVKKRTKHFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
10-48KKRTKHFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSPAHIPIVKKRTKHFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNRKTRHLIPSGYKELLVHNLADLDLLLMHSNKYAAAIAHGVSSKKRVEIVARAKVLGVKVTNAAAKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.79
4 0.84
5 0.91
6 0.91
7 0.9
8 0.88
9 0.86
10 0.83
11 0.76
12 0.67
13 0.62
14 0.62
15 0.6
16 0.62
17 0.63
18 0.62
19 0.6
20 0.61
21 0.64
22 0.66
23 0.67
24 0.67
25 0.68
26 0.72
27 0.8
28 0.84
29 0.77
30 0.74
31 0.71
32 0.67
33 0.67
34 0.64
35 0.64
36 0.63
37 0.65
38 0.59
39 0.52
40 0.46
41 0.37
42 0.36
43 0.33
44 0.34
45 0.39
46 0.4
47 0.41
48 0.44
49 0.44
50 0.44
51 0.42
52 0.38
53 0.33
54 0.38
55 0.4
56 0.37
57 0.35
58 0.29
59 0.24
60 0.24
61 0.2
62 0.13
63 0.09
64 0.09
65 0.09
66 0.08
67 0.07
68 0.04
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.06
79 0.05
80 0.07
81 0.08
82 0.08
83 0.09
84 0.11
85 0.12
86 0.12
87 0.16
88 0.16
89 0.16
90 0.17
91 0.18
92 0.21
93 0.3
94 0.38
95 0.42
96 0.43
97 0.42
98 0.41
99 0.41
100 0.37
101 0.32
102 0.24
103 0.17
104 0.17
105 0.19
106 0.21
107 0.2
108 0.21
109 0.19
110 0.19