Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BJE1

Protein Details
Accession A0A1Y2BJE1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41AQAGSKAGKKKKWSKGKVKDKANNAVIHydrophilic
NLS Segment(s)
PositionSequence
11-35KAAAAQAGSKAGKKKKWSKGKVKDK
Subcellular Location(s) nucl 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPQVKSKAQKAAAAQAGSKAGKKKKWSKGKVKDKANNAVILDKPTYDRIIKEVPTYRVISQSTLIDRMKIGGALARRAIAHLEKEGLIKRVVHHRAQLIYTRATVKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.33
4 0.34
5 0.31
6 0.31
7 0.3
8 0.32
9 0.36
10 0.46
11 0.54
12 0.6
13 0.7
14 0.77
15 0.81
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.82
23 0.73
24 0.65
25 0.54
26 0.48
27 0.38
28 0.33
29 0.26
30 0.18
31 0.16
32 0.15
33 0.16
34 0.14
35 0.13
36 0.14
37 0.17
38 0.17
39 0.2
40 0.23
41 0.23
42 0.25
43 0.27
44 0.24
45 0.25
46 0.24
47 0.21
48 0.18
49 0.18
50 0.16
51 0.19
52 0.19
53 0.15
54 0.15
55 0.15
56 0.14
57 0.11
58 0.1
59 0.08
60 0.1
61 0.11
62 0.12
63 0.12
64 0.11
65 0.12
66 0.14
67 0.14
68 0.14
69 0.14
70 0.15
71 0.15
72 0.18
73 0.2
74 0.2
75 0.19
76 0.19
77 0.21
78 0.29
79 0.34
80 0.34
81 0.37
82 0.4
83 0.41
84 0.43
85 0.47
86 0.4
87 0.38
88 0.37