Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BHS8

Protein Details
Accession A0A1Y2BHS8   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
147-175GAKRDRGAADVRKKKKKKVCDCLLVYLKGHydrophilic
NLS Segment(s)
PositionSequence
141-164REKEGWGAKRDRGAADVRKKKKKK
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MSLYSGIKFTAAELAAEAALNASEAAKKTAAASATAPTTSSSSSSPSGINKPAVPAKASAEWSASLKFAPRLNKPKPTTTARPPTTSYSAEPTVAVGIVKPLETTNKTKEDEIVLGVDGKPLAKAPAMTLAAAGQKEWSAREKEGWGAKRDRGAADVRKKKKKKVCDCLLVYLKGYTDVVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.07
11 0.08
12 0.1
13 0.1
14 0.11
15 0.11
16 0.14
17 0.14
18 0.14
19 0.14
20 0.14
21 0.15
22 0.15
23 0.15
24 0.13
25 0.13
26 0.13
27 0.13
28 0.11
29 0.13
30 0.15
31 0.15
32 0.16
33 0.18
34 0.22
35 0.24
36 0.25
37 0.22
38 0.25
39 0.27
40 0.27
41 0.24
42 0.22
43 0.22
44 0.23
45 0.24
46 0.21
47 0.18
48 0.18
49 0.18
50 0.17
51 0.15
52 0.11
53 0.11
54 0.13
55 0.15
56 0.2
57 0.27
58 0.35
59 0.4
60 0.5
61 0.52
62 0.54
63 0.57
64 0.59
65 0.57
66 0.57
67 0.62
68 0.55
69 0.55
70 0.52
71 0.5
72 0.47
73 0.42
74 0.34
75 0.28
76 0.26
77 0.23
78 0.2
79 0.16
80 0.12
81 0.1
82 0.09
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.08
90 0.11
91 0.15
92 0.19
93 0.24
94 0.25
95 0.26
96 0.26
97 0.25
98 0.23
99 0.2
100 0.16
101 0.11
102 0.11
103 0.1
104 0.1
105 0.08
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.13
114 0.14
115 0.13
116 0.13
117 0.14
118 0.15
119 0.15
120 0.14
121 0.09
122 0.09
123 0.1
124 0.11
125 0.15
126 0.16
127 0.18
128 0.2
129 0.22
130 0.27
131 0.34
132 0.38
133 0.39
134 0.41
135 0.42
136 0.44
137 0.45
138 0.4
139 0.35
140 0.38
141 0.41
142 0.47
143 0.55
144 0.6
145 0.68
146 0.74
147 0.81
148 0.83
149 0.85
150 0.85
151 0.86
152 0.86
153 0.86
154 0.84
155 0.84
156 0.81
157 0.72
158 0.63
159 0.53
160 0.43
161 0.34