Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BMB6

Protein Details
Accession A0A1Y2BMB6   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
150-171RGHTRDGTRKRIRSRSRSPGGDBasic
184-207SSPGGGRRRLRSPRSRSPPRDGGIBasic
NLS Segment(s)
PositionSequence
104-204RRSRSPDIPPPRRDSNPIPRIPSPSSRARPMRSRSPSRREQEGASSRGHTRDGTRKRIRSRSRSPGGDGGGRRRIRSRSRSSPGGGRRRLRSPRSRSPPRD
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPPPQREDERSWDARRDKAIPAEERYREQQKRSGEGSSTSTGLSGLPRRPSSPAQKTRSPSKGSEEYGSSRPRSPAHSLSDIYRRLETRRREDSAEPGQIVSPRRSRSPDIPPPRRDSNPIPRIPSPSSRARPMRSRSPSRREQEGASSRGHTRDGTRKRIRSRSRSPGGDGGGRRRIRSRSRSSPGGGRRRLRSPRSRSPPRDGGILKGEPGSVVLGLEGFTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.53
4 0.5
5 0.5
6 0.53
7 0.5
8 0.53
9 0.56
10 0.54
11 0.55
12 0.57
13 0.6
14 0.57
15 0.56
16 0.56
17 0.53
18 0.56
19 0.54
20 0.51
21 0.43
22 0.4
23 0.41
24 0.36
25 0.31
26 0.24
27 0.21
28 0.17
29 0.16
30 0.17
31 0.17
32 0.2
33 0.25
34 0.27
35 0.28
36 0.33
37 0.39
38 0.45
39 0.51
40 0.56
41 0.56
42 0.62
43 0.66
44 0.7
45 0.71
46 0.65
47 0.57
48 0.55
49 0.55
50 0.51
51 0.48
52 0.42
53 0.38
54 0.4
55 0.41
56 0.36
57 0.31
58 0.31
59 0.3
60 0.32
61 0.34
62 0.34
63 0.35
64 0.37
65 0.35
66 0.36
67 0.42
68 0.39
69 0.35
70 0.32
71 0.27
72 0.28
73 0.34
74 0.38
75 0.39
76 0.44
77 0.45
78 0.46
79 0.46
80 0.49
81 0.48
82 0.43
83 0.35
84 0.29
85 0.27
86 0.26
87 0.27
88 0.23
89 0.22
90 0.21
91 0.23
92 0.27
93 0.29
94 0.32
95 0.4
96 0.46
97 0.52
98 0.59
99 0.6
100 0.62
101 0.64
102 0.6
103 0.55
104 0.53
105 0.53
106 0.53
107 0.53
108 0.51
109 0.47
110 0.51
111 0.49
112 0.46
113 0.4
114 0.4
115 0.4
116 0.43
117 0.47
118 0.46
119 0.52
120 0.53
121 0.58
122 0.58
123 0.65
124 0.66
125 0.69
126 0.74
127 0.7
128 0.71
129 0.63
130 0.56
131 0.56
132 0.53
133 0.48
134 0.4
135 0.38
136 0.33
137 0.32
138 0.31
139 0.23
140 0.22
141 0.29
142 0.35
143 0.43
144 0.51
145 0.58
146 0.65
147 0.75
148 0.79
149 0.79
150 0.81
151 0.81
152 0.81
153 0.77
154 0.72
155 0.67
156 0.61
157 0.57
158 0.5
159 0.47
160 0.47
161 0.45
162 0.42
163 0.42
164 0.47
165 0.51
166 0.58
167 0.6
168 0.62
169 0.67
170 0.71
171 0.7
172 0.71
173 0.72
174 0.72
175 0.71
176 0.68
177 0.66
178 0.7
179 0.76
180 0.76
181 0.77
182 0.76
183 0.78
184 0.82
185 0.87
186 0.85
187 0.85
188 0.84
189 0.76
190 0.75
191 0.65
192 0.6
193 0.56
194 0.5
195 0.42
196 0.34
197 0.31
198 0.22
199 0.22
200 0.17
201 0.1
202 0.08
203 0.07
204 0.06