Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B2R8

Protein Details
Accession A0A1Y2B2R8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RLYTKGRILGHKRGKRNTRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
17-17R
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MVATRLYTKGRILGHKRGKRNTRPNQSLVQIEGVDSAEAARSYLGKRVAYVYKAKREINGSKVRVIWGRVTRPHGTNGVVKSKFRVNLPAKVFGASCRIMLFPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.86
10 0.85
11 0.81
12 0.76
13 0.7
14 0.61
15 0.51
16 0.43
17 0.32
18 0.25
19 0.21
20 0.15
21 0.11
22 0.09
23 0.07
24 0.05
25 0.05
26 0.05
27 0.04
28 0.05
29 0.06
30 0.1
31 0.13
32 0.12
33 0.13
34 0.16
35 0.18
36 0.2
37 0.27
38 0.28
39 0.32
40 0.36
41 0.36
42 0.35
43 0.39
44 0.4
45 0.4
46 0.44
47 0.39
48 0.37
49 0.37
50 0.37
51 0.33
52 0.31
53 0.3
54 0.27
55 0.3
56 0.32
57 0.37
58 0.39
59 0.39
60 0.4
61 0.36
62 0.33
63 0.32
64 0.32
65 0.36
66 0.35
67 0.33
68 0.33
69 0.37
70 0.37
71 0.33
72 0.4
73 0.35
74 0.42
75 0.46
76 0.5
77 0.45
78 0.44
79 0.43
80 0.34
81 0.34
82 0.27
83 0.23
84 0.17
85 0.17
86 0.16