Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AL56

Protein Details
Accession A0A1Y2AL56   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-84SEKGCKSHNRQRRCGTHNQSCGRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 6, cyto_mito 6, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVQTPLSPVSAEIQCLQLGHRKKTRYGPIGIIAGIVFFPWGLFWTACDRKVTCKRCQVVLSEKGCKSHNRQRRCGTHNQSCGRTGRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.19
5 0.24
6 0.3
7 0.35
8 0.37
9 0.41
10 0.5
11 0.58
12 0.57
13 0.54
14 0.5
15 0.47
16 0.46
17 0.4
18 0.32
19 0.22
20 0.16
21 0.12
22 0.08
23 0.04
24 0.03
25 0.03
26 0.02
27 0.03
28 0.05
29 0.05
30 0.06
31 0.13
32 0.15
33 0.17
34 0.19
35 0.19
36 0.26
37 0.36
38 0.41
39 0.41
40 0.48
41 0.49
42 0.52
43 0.54
44 0.5
45 0.49
46 0.52
47 0.5
48 0.49
49 0.48
50 0.46
51 0.47
52 0.46
53 0.47
54 0.48
55 0.52
56 0.53
57 0.62
58 0.69
59 0.76
60 0.78
61 0.8
62 0.8
63 0.81
64 0.82
65 0.8
66 0.74
67 0.69