Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AM19

Protein Details
Accession A0A1Y2AM19    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-26PPTSTNKQIKPSPRKSPYNHNQKHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14.333, mito_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MPPTSTNKQIKPSPRKSPYNHNQKHDNDNDDENDDVKPSSSPDSTTSPSKKPKSKVSRPWTAGDLLIIFDVVTKRGASIPNFEGMIEGRTGTQCYSNWKNTIAPSIQKMLVERGNKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.79
4 0.82
5 0.82
6 0.82
7 0.81
8 0.76
9 0.76
10 0.72
11 0.76
12 0.71
13 0.65
14 0.57
15 0.53
16 0.48
17 0.41
18 0.36
19 0.27
20 0.22
21 0.17
22 0.14
23 0.11
24 0.09
25 0.09
26 0.11
27 0.11
28 0.13
29 0.15
30 0.19
31 0.22
32 0.28
33 0.31
34 0.34
35 0.42
36 0.48
37 0.51
38 0.52
39 0.6
40 0.64
41 0.7
42 0.74
43 0.73
44 0.76
45 0.72
46 0.69
47 0.6
48 0.5
49 0.4
50 0.3
51 0.22
52 0.13
53 0.09
54 0.07
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.09
63 0.12
64 0.12
65 0.17
66 0.17
67 0.18
68 0.19
69 0.18
70 0.17
71 0.14
72 0.14
73 0.1
74 0.09
75 0.07
76 0.08
77 0.09
78 0.09
79 0.11
80 0.11
81 0.19
82 0.26
83 0.31
84 0.32
85 0.34
86 0.36
87 0.35
88 0.41
89 0.37
90 0.35
91 0.33
92 0.35
93 0.35
94 0.33
95 0.33
96 0.32
97 0.34
98 0.33