Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AVL9

Protein Details
Accession G3AVL9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MNKRKEHNRYRDPRTHQITPBasic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 10.5, nucl 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041752  Coa3  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG spaa:SPAPADRAFT_63797  -  
Amino Acid Sequences MNKRKEHNRYRDPRTHQITPALYRVRAPFFWRNTISFIALGSIPLGVYIYTFKKMQGDDLEDIPIPPISDEELKILKKEYEEKKAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.7
4 0.67
5 0.63
6 0.56
7 0.55
8 0.48
9 0.41
10 0.38
11 0.38
12 0.34
13 0.3
14 0.33
15 0.33
16 0.33
17 0.39
18 0.39
19 0.37
20 0.36
21 0.36
22 0.31
23 0.23
24 0.19
25 0.14
26 0.12
27 0.1
28 0.07
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.05
36 0.06
37 0.08
38 0.09
39 0.09
40 0.12
41 0.12
42 0.16
43 0.17
44 0.21
45 0.21
46 0.21
47 0.23
48 0.2
49 0.2
50 0.17
51 0.14
52 0.1
53 0.08
54 0.07
55 0.09
56 0.11
57 0.11
58 0.14
59 0.19
60 0.2
61 0.21
62 0.23
63 0.22
64 0.24
65 0.33
66 0.37
67 0.42