Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AWQ6

Protein Details
Accession A0A1Y2AWQ6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29EPAVDSLARKQRKRRKLLSCSECRRLKLHydrophilic
NLS Segment(s)
PositionSequence
11-17KQRKRRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MEPAVDSLARKQRKRRKLLSCSECRRLKLKCNREVPCSHCVRRKCVSMCSGQNEAEQQEGSRASLSSRVNLEESELITSQSHDKSGHSCSPHVYPFGTLRLIYLTSSRANRSLSYST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.83
4 0.85
5 0.89
6 0.89
7 0.9
8 0.87
9 0.87
10 0.82
11 0.74
12 0.7
13 0.64
14 0.64
15 0.64
16 0.66
17 0.65
18 0.7
19 0.71
20 0.7
21 0.71
22 0.65
23 0.63
24 0.6
25 0.57
26 0.54
27 0.53
28 0.53
29 0.51
30 0.55
31 0.49
32 0.47
33 0.45
34 0.45
35 0.46
36 0.45
37 0.43
38 0.36
39 0.33
40 0.29
41 0.26
42 0.2
43 0.15
44 0.1
45 0.09
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.12
52 0.12
53 0.13
54 0.14
55 0.15
56 0.15
57 0.15
58 0.16
59 0.12
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.11
66 0.13
67 0.12
68 0.13
69 0.12
70 0.13
71 0.15
72 0.21
73 0.25
74 0.24
75 0.25
76 0.26
77 0.3
78 0.31
79 0.3
80 0.25
81 0.23
82 0.23
83 0.25
84 0.24
85 0.19
86 0.17
87 0.18
88 0.18
89 0.16
90 0.15
91 0.15
92 0.19
93 0.22
94 0.25
95 0.26
96 0.28
97 0.29