Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ANR3

Protein Details
Accession A0A1Y2ANR3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-128RPIHTNRSSKNQRSTRRSLRHKKPSFTHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR004861  Siw14-like  
Pfam View protein in Pfam  
PF03162  Y_phosphatase2  
Amino Acid Sequences MTRPPPIQQQYSTMTSSTSASTSLDPPPLVVPPINFSLVAPGIYRSGHPNKKNFGFLRRLGLKGIMYVEGTEEYRKDSLDFVRTQGLVLHRFDLSKESVRPIHTNRSSKNQRSTRRSLRHKKPSFTHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.24
4 0.2
5 0.15
6 0.11
7 0.11
8 0.13
9 0.14
10 0.16
11 0.17
12 0.16
13 0.16
14 0.17
15 0.16
16 0.16
17 0.15
18 0.13
19 0.13
20 0.16
21 0.16
22 0.14
23 0.13
24 0.15
25 0.14
26 0.14
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.14
33 0.23
34 0.3
35 0.34
36 0.39
37 0.44
38 0.46
39 0.53
40 0.49
41 0.47
42 0.45
43 0.41
44 0.44
45 0.41
46 0.38
47 0.31
48 0.3
49 0.24
50 0.19
51 0.18
52 0.11
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.12
66 0.16
67 0.17
68 0.17
69 0.19
70 0.19
71 0.19
72 0.19
73 0.2
74 0.19
75 0.19
76 0.19
77 0.16
78 0.16
79 0.17
80 0.17
81 0.17
82 0.19
83 0.2
84 0.23
85 0.26
86 0.29
87 0.34
88 0.36
89 0.43
90 0.47
91 0.53
92 0.52
93 0.6
94 0.67
95 0.69
96 0.75
97 0.74
98 0.76
99 0.77
100 0.84
101 0.84
102 0.84
103 0.88
104 0.88
105 0.9
106 0.91
107 0.91
108 0.9