Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0ET68

Protein Details
Accession H0ET68    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
299-322SDARVLLPRSRKRSQRHESDTSDDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR047021  REXO1/3/4-like  
IPR036397  RNaseH_sf  
Gene Ontology GO:0004527  F:exonuclease activity  
GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MALDLEEEAALQPTVYSNLVKNKVLLYKRMTVSQWKTERQSDLAKAKALQEASTLSKPKPTEKPKEITTGLTTAQEIAFLPRLLTPTTALKSHGYVNTIPTPSEIQTANLGVEASKGWEVCDRCKSRFQVFPSRRPEDGALATGGTCTYHNGKPFWSDASATDATVKKQKKWRCCGEVIGDSPGCTTAACHVFKITEVKRLAAILNFVETPKVKGKKENGPVCIDGEMGYTVHGLELIRLTATSWPSGTALFDVLVKPVGAILDLNTRFSGVHPEDYTTAPAYSSSAPPDNLQLLPSISDARVLLPRSRKRSQRHESDTSDDHRHSAAVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.15
5 0.24
6 0.29
7 0.3
8 0.31
9 0.33
10 0.4
11 0.42
12 0.44
13 0.41
14 0.45
15 0.46
16 0.5
17 0.48
18 0.49
19 0.52
20 0.56
21 0.58
22 0.56
23 0.59
24 0.6
25 0.6
26 0.55
27 0.56
28 0.54
29 0.53
30 0.5
31 0.47
32 0.44
33 0.42
34 0.42
35 0.35
36 0.27
37 0.22
38 0.22
39 0.24
40 0.28
41 0.29
42 0.25
43 0.3
44 0.31
45 0.37
46 0.44
47 0.48
48 0.53
49 0.58
50 0.65
51 0.63
52 0.69
53 0.63
54 0.56
55 0.5
56 0.42
57 0.35
58 0.29
59 0.26
60 0.19
61 0.17
62 0.14
63 0.11
64 0.11
65 0.12
66 0.11
67 0.11
68 0.11
69 0.13
70 0.13
71 0.14
72 0.13
73 0.17
74 0.19
75 0.19
76 0.2
77 0.19
78 0.2
79 0.24
80 0.23
81 0.21
82 0.2
83 0.23
84 0.26
85 0.26
86 0.24
87 0.21
88 0.21
89 0.19
90 0.21
91 0.17
92 0.13
93 0.14
94 0.14
95 0.13
96 0.11
97 0.1
98 0.08
99 0.08
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.12
106 0.13
107 0.17
108 0.27
109 0.29
110 0.31
111 0.38
112 0.41
113 0.42
114 0.47
115 0.49
116 0.51
117 0.53
118 0.59
119 0.61
120 0.61
121 0.56
122 0.52
123 0.47
124 0.39
125 0.34
126 0.26
127 0.18
128 0.14
129 0.13
130 0.11
131 0.09
132 0.06
133 0.05
134 0.06
135 0.09
136 0.12
137 0.14
138 0.15
139 0.15
140 0.17
141 0.18
142 0.18
143 0.15
144 0.14
145 0.12
146 0.17
147 0.17
148 0.15
149 0.17
150 0.17
151 0.17
152 0.23
153 0.24
154 0.23
155 0.31
156 0.37
157 0.43
158 0.51
159 0.58
160 0.58
161 0.59
162 0.58
163 0.55
164 0.54
165 0.45
166 0.4
167 0.31
168 0.25
169 0.22
170 0.19
171 0.13
172 0.09
173 0.07
174 0.08
175 0.14
176 0.14
177 0.15
178 0.15
179 0.15
180 0.16
181 0.23
182 0.2
183 0.22
184 0.23
185 0.23
186 0.23
187 0.24
188 0.23
189 0.16
190 0.17
191 0.09
192 0.1
193 0.1
194 0.09
195 0.1
196 0.1
197 0.12
198 0.19
199 0.24
200 0.24
201 0.31
202 0.37
203 0.45
204 0.55
205 0.58
206 0.54
207 0.53
208 0.53
209 0.47
210 0.41
211 0.32
212 0.22
213 0.16
214 0.13
215 0.08
216 0.07
217 0.06
218 0.06
219 0.05
220 0.06
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.09
229 0.1
230 0.1
231 0.1
232 0.11
233 0.11
234 0.12
235 0.12
236 0.09
237 0.08
238 0.08
239 0.09
240 0.08
241 0.08
242 0.09
243 0.08
244 0.07
245 0.07
246 0.07
247 0.06
248 0.06
249 0.06
250 0.14
251 0.15
252 0.16
253 0.16
254 0.16
255 0.16
256 0.17
257 0.24
258 0.18
259 0.23
260 0.23
261 0.25
262 0.27
263 0.28
264 0.3
265 0.22
266 0.2
267 0.15
268 0.14
269 0.14
270 0.15
271 0.15
272 0.18
273 0.19
274 0.2
275 0.21
276 0.24
277 0.25
278 0.23
279 0.21
280 0.18
281 0.16
282 0.16
283 0.16
284 0.15
285 0.12
286 0.14
287 0.14
288 0.15
289 0.19
290 0.21
291 0.26
292 0.34
293 0.43
294 0.49
295 0.58
296 0.64
297 0.69
298 0.77
299 0.81
300 0.82
301 0.82
302 0.83
303 0.8
304 0.78
305 0.75
306 0.7
307 0.67
308 0.56
309 0.49
310 0.41
311 0.35