Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AQ43

Protein Details
Accession A0A1Y2AQ43    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-75NKRDCKEKGFLERKRRKKDRHVKAISRSIVKBasic
NLS Segment(s)
PositionSequence
22-26VKKRE
50-68KEKGFLERKRRKKDRHVKA
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAQEPVPYHIPKEEKERKTFAVKKREKLEKASQQDLIKDSYPRENKRDCKEKGFLERKRRKKDRHVKAISRSIVKGYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.57
4 0.55
5 0.62
6 0.67
7 0.64
8 0.65
9 0.66
10 0.67
11 0.72
12 0.77
13 0.7
14 0.69
15 0.7
16 0.69
17 0.68
18 0.63
19 0.59
20 0.5
21 0.49
22 0.43
23 0.35
24 0.27
25 0.22
26 0.2
27 0.23
28 0.29
29 0.31
30 0.35
31 0.41
32 0.47
33 0.55
34 0.63
35 0.58
36 0.58
37 0.6
38 0.6
39 0.63
40 0.66
41 0.66
42 0.68
43 0.75
44 0.78
45 0.84
46 0.88
47 0.86
48 0.87
49 0.9
50 0.9
51 0.91
52 0.91
53 0.89
54 0.89
55 0.89
56 0.84
57 0.78
58 0.68