Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BDU5

Protein Details
Accession A0A1Y2BDU5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
153-176THDLPIKKNKTKNKAKMKMGEEKEBasic
NLS Segment(s)
PositionSequence
159-180KKNKTKNKAKMKMGEEKEKEKE
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 8.5, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR045054  P4HA-like  
IPR006620  Pro_4_hyd_alph  
IPR044862  Pro_4_hyd_alph_FE2OG_OXY  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0031418  F:L-ascorbic acid binding  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF13640  2OG-FeII_Oxy_3  
Amino Acid Sequences MPIPFPNLVTNREIPLVEVVPQQIYTLDGVLSPCTLKDLLAWSSSLSLDPPKPPAKGEAERTSRRAALPSSEIASSLLSILSPYLARLDPNLKQPYLLSPNIRIYHYPPSSFFKPHYDTPQLDLTSRRLSCWTVLIYLSDGVRGGGTTFHLDTHDLPIKKNKTKNKAKMKMGEEKEKEKEKVAVTVQPKAGRILFHWHGIQRGGCLLHQGDEVLGGDKWVLRTDVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.23
4 0.2
5 0.2
6 0.18
7 0.17
8 0.17
9 0.16
10 0.12
11 0.12
12 0.11
13 0.09
14 0.08
15 0.08
16 0.09
17 0.09
18 0.09
19 0.09
20 0.08
21 0.1
22 0.1
23 0.09
24 0.1
25 0.13
26 0.14
27 0.15
28 0.15
29 0.14
30 0.15
31 0.15
32 0.14
33 0.11
34 0.13
35 0.15
36 0.16
37 0.22
38 0.25
39 0.26
40 0.27
41 0.31
42 0.34
43 0.38
44 0.44
45 0.47
46 0.51
47 0.54
48 0.56
49 0.54
50 0.48
51 0.43
52 0.38
53 0.3
54 0.25
55 0.24
56 0.23
57 0.21
58 0.19
59 0.19
60 0.16
61 0.15
62 0.11
63 0.08
64 0.07
65 0.05
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.06
72 0.06
73 0.07
74 0.09
75 0.13
76 0.15
77 0.23
78 0.26
79 0.24
80 0.24
81 0.24
82 0.28
83 0.29
84 0.29
85 0.23
86 0.23
87 0.29
88 0.3
89 0.3
90 0.26
91 0.23
92 0.3
93 0.3
94 0.27
95 0.24
96 0.29
97 0.3
98 0.31
99 0.3
100 0.26
101 0.28
102 0.3
103 0.34
104 0.32
105 0.3
106 0.32
107 0.36
108 0.3
109 0.28
110 0.27
111 0.24
112 0.26
113 0.25
114 0.22
115 0.19
116 0.19
117 0.19
118 0.2
119 0.18
120 0.12
121 0.12
122 0.12
123 0.11
124 0.12
125 0.11
126 0.08
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.05
134 0.07
135 0.07
136 0.08
137 0.08
138 0.1
139 0.1
140 0.16
141 0.22
142 0.21
143 0.22
144 0.3
145 0.37
146 0.44
147 0.51
148 0.54
149 0.58
150 0.68
151 0.77
152 0.8
153 0.82
154 0.83
155 0.84
156 0.81
157 0.81
158 0.76
159 0.76
160 0.69
161 0.66
162 0.65
163 0.64
164 0.59
165 0.51
166 0.5
167 0.41
168 0.43
169 0.39
170 0.39
171 0.35
172 0.4
173 0.42
174 0.4
175 0.39
176 0.36
177 0.34
178 0.28
179 0.27
180 0.3
181 0.28
182 0.29
183 0.31
184 0.3
185 0.31
186 0.33
187 0.31
188 0.24
189 0.25
190 0.22
191 0.18
192 0.21
193 0.19
194 0.18
195 0.17
196 0.16
197 0.13
198 0.13
199 0.13
200 0.11
201 0.1
202 0.09
203 0.09
204 0.1
205 0.11
206 0.12
207 0.12