Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BJ48

Protein Details
Accession A0A1Y2BJ48    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
13-37LPYTEPNSRSHSRKKSQKVRFEMIVHydrophilic
169-205EMKWLEKEKKRREKEEEKRLKREEKWHRKHPFRSLPIBasic
NLS Segment(s)
PositionSequence
159-205TRMAEKAKKEEMKWLEKEKKRREKEEEKRLKREEKWHRKHPFRSLPI
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MPDPAVDAARLGLPYTEPNSRSHSRKKSQKVRFEMIVDPSDPSAPPRPRRVLEKKSGSGFGLLDRIRWGNEPDLPTTRPIGTSGRPLPQLGATTNKHFAAQGLAAHDPTPSALPPNLEAHIVPHSFPPDFAYLPRNEKRYLERMHREELRGIKAIHEGTRMAEKAKKEEMKWLEKEKKRREKEEEKRLKREEKWHRKHPFRSLPIPSKPGPATPTAAPPPATVQPTGWMMLPTHEEFGIRRPFDSPGRPAGLGGPVRAPEWPMMSRTMSHAITDMAREERVHLVNGGRLWTPTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.23
4 0.23
5 0.26
6 0.33
7 0.39
8 0.46
9 0.52
10 0.59
11 0.63
12 0.72
13 0.8
14 0.84
15 0.87
16 0.9
17 0.88
18 0.85
19 0.8
20 0.73
21 0.67
22 0.61
23 0.54
24 0.45
25 0.37
26 0.3
27 0.26
28 0.22
29 0.22
30 0.26
31 0.31
32 0.37
33 0.45
34 0.51
35 0.54
36 0.64
37 0.71
38 0.71
39 0.73
40 0.75
41 0.72
42 0.69
43 0.67
44 0.57
45 0.49
46 0.39
47 0.31
48 0.28
49 0.23
50 0.19
51 0.19
52 0.19
53 0.18
54 0.2
55 0.21
56 0.17
57 0.22
58 0.23
59 0.25
60 0.28
61 0.28
62 0.28
63 0.28
64 0.25
65 0.21
66 0.21
67 0.21
68 0.19
69 0.25
70 0.27
71 0.29
72 0.3
73 0.29
74 0.28
75 0.26
76 0.26
77 0.2
78 0.23
79 0.21
80 0.24
81 0.26
82 0.25
83 0.24
84 0.22
85 0.21
86 0.16
87 0.15
88 0.13
89 0.12
90 0.13
91 0.12
92 0.13
93 0.12
94 0.09
95 0.09
96 0.08
97 0.06
98 0.07
99 0.08
100 0.08
101 0.11
102 0.13
103 0.13
104 0.12
105 0.12
106 0.12
107 0.15
108 0.15
109 0.13
110 0.12
111 0.13
112 0.13
113 0.13
114 0.14
115 0.12
116 0.12
117 0.13
118 0.16
119 0.16
120 0.24
121 0.27
122 0.28
123 0.27
124 0.29
125 0.32
126 0.36
127 0.38
128 0.4
129 0.44
130 0.45
131 0.49
132 0.49
133 0.46
134 0.42
135 0.4
136 0.34
137 0.29
138 0.26
139 0.22
140 0.21
141 0.21
142 0.18
143 0.16
144 0.14
145 0.11
146 0.15
147 0.14
148 0.13
149 0.15
150 0.15
151 0.18
152 0.25
153 0.27
154 0.25
155 0.33
156 0.38
157 0.42
158 0.46
159 0.51
160 0.54
161 0.56
162 0.66
163 0.69
164 0.73
165 0.72
166 0.76
167 0.77
168 0.78
169 0.83
170 0.84
171 0.85
172 0.82
173 0.84
174 0.82
175 0.8
176 0.75
177 0.75
178 0.75
179 0.75
180 0.76
181 0.78
182 0.81
183 0.83
184 0.84
185 0.85
186 0.83
187 0.79
188 0.78
189 0.76
190 0.75
191 0.71
192 0.69
193 0.6
194 0.55
195 0.49
196 0.43
197 0.37
198 0.31
199 0.28
200 0.25
201 0.3
202 0.27
203 0.28
204 0.26
205 0.24
206 0.25
207 0.26
208 0.27
209 0.21
210 0.19
211 0.2
212 0.2
213 0.21
214 0.17
215 0.14
216 0.12
217 0.14
218 0.17
219 0.16
220 0.15
221 0.15
222 0.15
223 0.14
224 0.21
225 0.28
226 0.24
227 0.24
228 0.24
229 0.28
230 0.34
231 0.39
232 0.36
233 0.34
234 0.38
235 0.37
236 0.36
237 0.34
238 0.35
239 0.3
240 0.27
241 0.23
242 0.2
243 0.2
244 0.2
245 0.2
246 0.15
247 0.18
248 0.19
249 0.18
250 0.21
251 0.22
252 0.23
253 0.25
254 0.29
255 0.25
256 0.24
257 0.23
258 0.22
259 0.21
260 0.22
261 0.2
262 0.16
263 0.17
264 0.17
265 0.19
266 0.23
267 0.24
268 0.24
269 0.23
270 0.23
271 0.26
272 0.27
273 0.27
274 0.22