FuNGI

A0A1Y2AUH2

Protein Details

Accession

A0A1Y2AUH2

Localization Confidence

Low

Confidence Score

7.6

NoLS Segment(s)

Position	Sequence	Protein Nature
411-433	FADQRFARKDKREKLPRWIDQYI	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto_nucl 9, nucl 8.5, cyto 8.5, cysk 7

Family & Domain DBs

InterPro	View protein in InterPro IPR006555 ATP-dep_Helicase_C IPR045028 DinG/Rad3-like IPR010643 HBB IPR027417 P-loop_NTPase IPR013020 Rad3/Chl1-like IPR001945 RAD3/XPD
Gene Ontology	GO:0005634 C:nucleus GO:0005524 F:ATP binding GO:0003677 F:DNA binding GO:0003678 F:DNA helicase activity GO:0016818 F:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides GO:0006289 P:nucleotide-excision repair
Pfam	View protein in Pfam PF06777 HBB PF13307 Helicase_C_2
CDD	cd18788 SF2_C_XPD

Amino Acid Sequences

MKKTDADKLQNEYEKLVAGLQEANQDGEDNDMLSNPVDSLTLSKDMLDEAIPGNIRKAEHFIAFLKRFIEYLKTRMRVLHVVAETPQSFLAHLKEITFIEKRPLKFAAERLTSLVRTLELTNIDEHYSLQKVAGFGTLVASYESGFLLILEPYETEHATVPNPIFHFTCLDPSLAIQPVFERFSSVIITSGTISPLDMYPKMLRFQAVKEVSYPMTLTRNAFFPMVITRGSDQVPISSRFEVRNDPAVVRNFGSILVDMSRVVPDGIVAFFPSYLYMESIVSAWYDMGILSEVWKHKLLFVETPDAMETSIALKNYREACNNGRGAVLLSVARGKVSEGIDFDHHYGRAVIMFGIPYQYTESRILKARLEFLRDNYRIKENEFLTFDAMRHAAQCVGRVLRGKTDWGLMVFADQRFARKDKREKLPRWIDQYIIEQHSNLSTDTAVLLAKKFIRQISQPFDHTQTGISLWTLEDIEEKQRKDKEEMDRAAATLPELAPVAPAVEEDYAMEVDIEDGIDDSVLAGMDIPVGM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.37
2	0.32
3	0.27
4	0.19
5	0.14
6	0.15
7	0.14
8	0.18
9	0.17
10	0.18
11	0.16
12	0.16
13	0.15
14	0.16
15	0.14
16	0.11
17	0.1
18	0.1
19	0.11
20	0.1
21	0.11
22	0.08
23	0.08
24	0.07
25	0.07
26	0.09
27	0.12
28	0.14
29	0.14
30	0.14
31	0.14
32	0.14
33	0.15
34	0.13
35	0.11
36	0.09
37	0.13
38	0.14
39	0.14
40	0.16
41	0.18
42	0.18
43	0.18
44	0.23
45	0.22
46	0.22
47	0.25
48	0.27
49	0.34
50	0.35
51	0.35
52	0.31
53	0.28
54	0.27
55	0.25
56	0.3
57	0.23
58	0.3
59	0.37
60	0.39
61	0.4
62	0.42
63	0.45
64	0.41
65	0.41
66	0.4
67	0.32
68	0.31
69	0.31
70	0.33
71	0.29
72	0.25
73	0.23
74	0.15
75	0.15
76	0.16
77	0.16
78	0.15
79	0.15
80	0.15
81	0.17
82	0.17
83	0.22
84	0.22
85	0.21
86	0.26
87	0.31
88	0.32
89	0.33
90	0.35
91	0.34
92	0.36
93	0.41
94	0.42
95	0.39
96	0.39
97	0.38
98	0.39
99	0.35
100	0.32
101	0.26
102	0.17
103	0.16
104	0.16
105	0.15
106	0.14
107	0.15
108	0.15
109	0.16
110	0.16
111	0.14
112	0.14
113	0.14
114	0.14
115	0.13
116	0.12
117	0.12
118	0.12
119	0.12
120	0.12
121	0.1
122	0.08
123	0.1
124	0.09
125	0.08
126	0.08
127	0.07
128	0.07
129	0.07
130	0.07
131	0.05
132	0.05
133	0.05
134	0.05
135	0.05
136	0.05
137	0.05
138	0.05
139	0.06
140	0.07
141	0.07
142	0.07
143	0.08
144	0.09
145	0.1
146	0.13
147	0.13
148	0.14
149	0.15
150	0.16
151	0.16
152	0.16
153	0.18
154	0.15
155	0.19
156	0.16
157	0.16
158	0.14
159	0.14
160	0.16
161	0.15
162	0.15
163	0.11
164	0.11
165	0.13
166	0.15
167	0.14
168	0.13
169	0.11
170	0.12
171	0.13
172	0.12
173	0.1
174	0.09
175	0.1
176	0.09
177	0.09
178	0.09
179	0.08
180	0.07
181	0.07
182	0.07
183	0.09
184	0.08
185	0.11
186	0.13
187	0.15
188	0.16
189	0.16
190	0.17
191	0.16
192	0.18
193	0.25
194	0.24
195	0.23
196	0.22
197	0.24
198	0.23
199	0.22
200	0.2
201	0.12
202	0.13
203	0.14
204	0.14
205	0.13
206	0.14
207	0.15
208	0.14
209	0.13
210	0.11
211	0.11
212	0.11
213	0.1
214	0.1
215	0.09
216	0.11
217	0.12
218	0.12
219	0.1
220	0.11
221	0.14
222	0.16
223	0.17
224	0.17
225	0.18
226	0.18
227	0.2
228	0.21
229	0.2
230	0.24
231	0.22
232	0.22
233	0.25
234	0.26
235	0.25
236	0.23
237	0.21
238	0.15
239	0.13
240	0.13
241	0.08
242	0.07
243	0.06
244	0.06
245	0.06
246	0.06
247	0.06
248	0.06
249	0.05
250	0.05
251	0.04
252	0.04
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.04
259	0.04
260	0.04
261	0.04
262	0.05
263	0.05
264	0.05
265	0.06
266	0.06
267	0.06
268	0.05
269	0.05
270	0.04
271	0.03
272	0.04
273	0.03
274	0.03
275	0.04
276	0.03
277	0.04
278	0.07
279	0.08
280	0.1
281	0.11
282	0.11
283	0.13
284	0.15
285	0.17
286	0.17
287	0.18
288	0.21
289	0.2
290	0.2
291	0.19
292	0.16
293	0.14
294	0.11
295	0.09
296	0.07
297	0.08
298	0.08
299	0.09
300	0.09
301	0.13
302	0.18
303	0.2
304	0.2
305	0.23
306	0.26
307	0.32
308	0.33
309	0.29
310	0.24
311	0.22
312	0.21
313	0.17
314	0.14
315	0.07
316	0.07
317	0.08
318	0.08
319	0.07
320	0.07
321	0.07
322	0.1
323	0.11
324	0.12
325	0.11
326	0.13
327	0.14
328	0.16
329	0.17
330	0.15
331	0.14
332	0.13
333	0.13
334	0.11
335	0.1
336	0.09
337	0.08
338	0.06
339	0.06
340	0.06
341	0.07
342	0.07
343	0.07
344	0.09
345	0.1
346	0.13
347	0.17
348	0.19
349	0.2
350	0.25
351	0.27
352	0.27
353	0.28
354	0.32
355	0.3
356	0.35
357	0.34
358	0.34
359	0.42
360	0.41
361	0.43
362	0.38
363	0.42
364	0.37
365	0.37
366	0.39
367	0.3
368	0.33
369	0.32
370	0.3
371	0.27
372	0.26
373	0.25
374	0.2
375	0.19
376	0.14
377	0.13
378	0.13
379	0.13
380	0.13
381	0.15
382	0.16
383	0.17
384	0.19
385	0.23
386	0.23
387	0.25
388	0.25
389	0.26
390	0.23
391	0.24
392	0.23
393	0.19
394	0.19
395	0.13
396	0.15
397	0.16
398	0.15
399	0.16
400	0.15
401	0.17
402	0.2
403	0.25
404	0.3
405	0.36
406	0.47
407	0.53
408	0.64
409	0.72
410	0.74
411	0.81
412	0.84
413	0.82
414	0.8
415	0.72
416	0.63
417	0.56
418	0.56
419	0.51
420	0.45
421	0.38
422	0.3
423	0.28
424	0.28
425	0.26
426	0.2
427	0.14
428	0.09
429	0.09
430	0.09
431	0.09
432	0.08
433	0.08
434	0.09
435	0.11
436	0.13
437	0.15
438	0.19
439	0.21
440	0.24
441	0.29
442	0.37
443	0.42
444	0.46
445	0.48
446	0.48
447	0.5
448	0.47
449	0.42
450	0.35
451	0.27
452	0.22
453	0.19
454	0.15
455	0.11
456	0.09
457	0.1
458	0.1
459	0.08
460	0.1
461	0.11
462	0.21
463	0.26
464	0.28
465	0.34
466	0.39
467	0.43
468	0.46
469	0.52
470	0.53
471	0.58
472	0.6
473	0.59
474	0.55
475	0.51
476	0.47
477	0.39
478	0.29
479	0.22
480	0.17
481	0.13
482	0.12
483	0.11
484	0.1
485	0.1
486	0.1
487	0.07
488	0.07
489	0.08
490	0.08
491	0.08
492	0.08
493	0.1
494	0.09
495	0.09
496	0.09
497	0.07
498	0.07
499	0.07
500	0.07
501	0.05
502	0.05
503	0.05
504	0.05
505	0.05
506	0.04
507	0.05
508	0.05
509	0.05
510	0.04
511	0.04

A0A1Y2AUH2

3D AlphaFold-predicted Structure Viewer