Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0ECC3

Protein Details
Accession H0ECC3   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
233-252ATGGAKRVGAKKKKGRGYIDBasic
NLS Segment(s)
PositionSequence
237-248AKRVGAKKKKGR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024880  Sec16  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006914  P:autophagy  
GO:0048208  P:COPII vesicle coating  
Amino Acid Sequences MGDEPDSPIDTKPRKKSFMDDDDDDISIPKKTSATGEKSKAEKDREAEEAFRKAAEADAQKGNAAPAKKGWGLGGWFGGGKKEAADMSAQPNKPIRAKLGEQSSFYYDPDLKRWINKKGGDTAPTPSATPPPPRAGPPRTASGTPLGAAAPPLRGPPAVRSASESAKGPSPLAQDDGPAASTGDLPSLAPPGPLAMARSASNGSVNGPPSAPPSRPGTGMSNASSIDDLLGPATGGAKRVGAKKKKGRGYIDVMGEKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.7
4 0.7
5 0.71
6 0.7
7 0.63
8 0.59
9 0.55
10 0.52
11 0.43
12 0.34
13 0.25
14 0.2
15 0.17
16 0.14
17 0.12
18 0.12
19 0.19
20 0.26
21 0.33
22 0.4
23 0.45
24 0.5
25 0.53
26 0.58
27 0.59
28 0.56
29 0.53
30 0.48
31 0.46
32 0.45
33 0.45
34 0.43
35 0.4
36 0.38
37 0.33
38 0.3
39 0.26
40 0.21
41 0.19
42 0.2
43 0.18
44 0.19
45 0.21
46 0.22
47 0.22
48 0.22
49 0.22
50 0.2
51 0.18
52 0.15
53 0.13
54 0.18
55 0.18
56 0.19
57 0.18
58 0.17
59 0.17
60 0.17
61 0.16
62 0.12
63 0.12
64 0.11
65 0.11
66 0.09
67 0.08
68 0.07
69 0.08
70 0.07
71 0.07
72 0.09
73 0.09
74 0.15
75 0.23
76 0.22
77 0.24
78 0.27
79 0.29
80 0.31
81 0.31
82 0.28
83 0.26
84 0.28
85 0.31
86 0.36
87 0.36
88 0.34
89 0.35
90 0.35
91 0.31
92 0.29
93 0.25
94 0.19
95 0.18
96 0.19
97 0.22
98 0.19
99 0.24
100 0.29
101 0.33
102 0.38
103 0.4
104 0.4
105 0.43
106 0.44
107 0.41
108 0.37
109 0.33
110 0.29
111 0.26
112 0.24
113 0.17
114 0.18
115 0.17
116 0.19
117 0.2
118 0.21
119 0.21
120 0.24
121 0.31
122 0.31
123 0.34
124 0.33
125 0.34
126 0.33
127 0.32
128 0.3
129 0.26
130 0.23
131 0.18
132 0.15
133 0.11
134 0.09
135 0.09
136 0.08
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.08
143 0.1
144 0.17
145 0.17
146 0.17
147 0.21
148 0.23
149 0.25
150 0.26
151 0.24
152 0.18
153 0.2
154 0.2
155 0.17
156 0.16
157 0.17
158 0.16
159 0.17
160 0.16
161 0.13
162 0.14
163 0.14
164 0.11
165 0.09
166 0.08
167 0.06
168 0.07
169 0.07
170 0.06
171 0.06
172 0.06
173 0.06
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.08
181 0.09
182 0.08
183 0.1
184 0.1
185 0.12
186 0.13
187 0.12
188 0.13
189 0.12
190 0.13
191 0.15
192 0.16
193 0.15
194 0.15
195 0.15
196 0.19
197 0.23
198 0.21
199 0.21
200 0.26
201 0.27
202 0.28
203 0.3
204 0.3
205 0.31
206 0.34
207 0.33
208 0.28
209 0.26
210 0.26
211 0.23
212 0.18
213 0.14
214 0.1
215 0.08
216 0.07
217 0.07
218 0.06
219 0.05
220 0.08
221 0.08
222 0.09
223 0.09
224 0.12
225 0.16
226 0.24
227 0.35
228 0.41
229 0.52
230 0.6
231 0.7
232 0.76
233 0.81
234 0.8
235 0.78
236 0.77
237 0.74
238 0.73
239 0.68