Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VZ48

Protein Details
Accession A0A1Y1VZ48    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
89-115CEHPGCSKRFTRKTSLRKHMQTHDPDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences CSWHNCDRSFARKSDLVRHFRIHTGIKPFECPWAGCEKRFIQRSALKVHYRTHSGERPHTCEVCERSFSDSSSLARHRRTHTGVRPYGCEHPGCSKRFTRKTSLRKHMQTHDPDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.53
4 0.53
5 0.55
6 0.52
7 0.5
8 0.52
9 0.45
10 0.42
11 0.43
12 0.44
13 0.4
14 0.41
15 0.39
16 0.39
17 0.36
18 0.31
19 0.25
20 0.3
21 0.31
22 0.28
23 0.33
24 0.32
25 0.38
26 0.41
27 0.4
28 0.37
29 0.39
30 0.42
31 0.43
32 0.46
33 0.42
34 0.41
35 0.44
36 0.39
37 0.38
38 0.37
39 0.36
40 0.35
41 0.35
42 0.4
43 0.39
44 0.42
45 0.41
46 0.39
47 0.34
48 0.33
49 0.34
50 0.28
51 0.27
52 0.23
53 0.24
54 0.25
55 0.24
56 0.22
57 0.19
58 0.18
59 0.21
60 0.25
61 0.25
62 0.29
63 0.34
64 0.35
65 0.41
66 0.45
67 0.5
68 0.53
69 0.59
70 0.6
71 0.57
72 0.57
73 0.53
74 0.54
75 0.47
76 0.39
77 0.32
78 0.36
79 0.41
80 0.4
81 0.42
82 0.44
83 0.52
84 0.6
85 0.63
86 0.63
87 0.67
88 0.75
89 0.81
90 0.83
91 0.83
92 0.83
93 0.85
94 0.84
95 0.83