Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WKU9

Protein Details
Accession A0A1Y1WKU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-44RIPWRLSKTRKANVRKRLREVDSHydrophilic
NLS Segment(s)
PositionSequence
29-37KTRKANVRK
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGSFLGAFKPTMATLGGRAWRIPWRLSKTRKANVRKRLREVDSVVDTLLASGVQCKQLDAIKDMPREAEMLARDKYTTFSRTAKNHRKGVHKVPHFTKRPIPRTTPAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.16
4 0.19
5 0.19
6 0.19
7 0.2
8 0.25
9 0.28
10 0.29
11 0.33
12 0.38
13 0.47
14 0.54
15 0.62
16 0.65
17 0.7
18 0.75
19 0.77
20 0.78
21 0.79
22 0.83
23 0.81
24 0.8
25 0.81
26 0.75
27 0.7
28 0.63
29 0.58
30 0.5
31 0.42
32 0.34
33 0.25
34 0.21
35 0.15
36 0.12
37 0.06
38 0.03
39 0.04
40 0.05
41 0.07
42 0.07
43 0.07
44 0.08
45 0.1
46 0.12
47 0.14
48 0.19
49 0.22
50 0.23
51 0.23
52 0.22
53 0.21
54 0.2
55 0.18
56 0.15
57 0.12
58 0.14
59 0.15
60 0.15
61 0.15
62 0.15
63 0.18
64 0.18
65 0.18
66 0.18
67 0.23
68 0.29
69 0.37
70 0.48
71 0.56
72 0.61
73 0.65
74 0.68
75 0.72
76 0.73
77 0.76
78 0.75
79 0.72
80 0.73
81 0.74
82 0.78
83 0.75
84 0.73
85 0.72
86 0.72
87 0.72
88 0.71
89 0.69
90 0.65