Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WF18

Protein Details
Accession A0A1Y1WF18    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSKSKNHTNHNQNKKAHRNGIKKPKANRYPSHydrophilic
NLS Segment(s)
PositionSequence
14-50KKAHRNGIKKPKANRYPSLKGVDPKFLRNQRFAKRGT
Subcellular Location(s) nucl 16.5, mito_nucl 12, mito 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHRNGIKKPKANRYPSLKGVDPKFLRNQRFAKRGTFKVVHKAKMAAKAAEGCPAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.82
4 0.82
5 0.8
6 0.81
7 0.85
8 0.84
9 0.82
10 0.81
11 0.82
12 0.81
13 0.78
14 0.76
15 0.73
16 0.7
17 0.68
18 0.65
19 0.57
20 0.52
21 0.48
22 0.48
23 0.4
24 0.37
25 0.4
26 0.42
27 0.42
28 0.45
29 0.51
30 0.51
31 0.56
32 0.55
33 0.56
34 0.56
35 0.56
36 0.57
37 0.55
38 0.49
39 0.54
40 0.58
41 0.53
42 0.48
43 0.5
44 0.47
45 0.5
46 0.51
47 0.41
48 0.38
49 0.39
50 0.38