Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W318

Protein Details
Accession A0A1Y1W318   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-109PPGLVLDRRSRRRWRVRVRRAVQLLRHydrophilic
NLS Segment(s)
PositionSequence
91-103RRSRRRWRVRVRR
Subcellular Location(s) extr 19, plas 4, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRCSGVGRSALVVAVLVVAVQDGGCGQRAVLLRAEAALAESVIHNIVPVPDLALEPAVARRRRGLVHGHQRALGRRHALGVHQPPGLVLDRRSRRRWRVRVRRAVQLLRGQLSADRVPVVLRLLLPIVLRHRRCIAASRPAVDVITCDSAASDELGSAIEYSPAPSSYTGCSVSYICCPSCMISPSACLSMISPSYAYSPWCPSSSICPPFSCVARIDPASAYSPWAASPCSPAVISTSPMSYCSYSCSYCASSSSPPLPCSTISYVSPVSASLTASAICVAISVSFSSASDVSLPEYTGSCALISDSSPVPSTAASSSPAATSAGAGLFAVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.05
11 0.06
12 0.06
13 0.06
14 0.11
15 0.13
16 0.15
17 0.17
18 0.17
19 0.16
20 0.17
21 0.17
22 0.12
23 0.11
24 0.09
25 0.07
26 0.06
27 0.06
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.07
34 0.07
35 0.06
36 0.07
37 0.07
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.13
44 0.2
45 0.22
46 0.23
47 0.26
48 0.29
49 0.31
50 0.35
51 0.38
52 0.41
53 0.5
54 0.57
55 0.55
56 0.55
57 0.57
58 0.59
59 0.54
60 0.48
61 0.4
62 0.33
63 0.33
64 0.31
65 0.3
66 0.32
67 0.34
68 0.33
69 0.3
70 0.29
71 0.26
72 0.28
73 0.28
74 0.22
75 0.18
76 0.24
77 0.33
78 0.4
79 0.48
80 0.55
81 0.63
82 0.72
83 0.8
84 0.82
85 0.84
86 0.89
87 0.92
88 0.87
89 0.85
90 0.82
91 0.76
92 0.7
93 0.65
94 0.57
95 0.48
96 0.43
97 0.34
98 0.27
99 0.26
100 0.21
101 0.16
102 0.13
103 0.11
104 0.11
105 0.11
106 0.11
107 0.08
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.1
114 0.15
115 0.23
116 0.23
117 0.25
118 0.27
119 0.27
120 0.28
121 0.32
122 0.32
123 0.33
124 0.35
125 0.35
126 0.33
127 0.32
128 0.31
129 0.24
130 0.19
131 0.12
132 0.11
133 0.09
134 0.08
135 0.07
136 0.08
137 0.08
138 0.08
139 0.05
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.07
152 0.07
153 0.08
154 0.08
155 0.1
156 0.11
157 0.1
158 0.11
159 0.11
160 0.12
161 0.13
162 0.14
163 0.12
164 0.11
165 0.11
166 0.11
167 0.13
168 0.14
169 0.13
170 0.11
171 0.12
172 0.13
173 0.14
174 0.13
175 0.11
176 0.1
177 0.1
178 0.1
179 0.09
180 0.08
181 0.07
182 0.09
183 0.09
184 0.1
185 0.1
186 0.13
187 0.15
188 0.16
189 0.16
190 0.15
191 0.21
192 0.29
193 0.32
194 0.3
195 0.29
196 0.31
197 0.32
198 0.32
199 0.28
200 0.2
201 0.17
202 0.19
203 0.19
204 0.18
205 0.16
206 0.16
207 0.17
208 0.16
209 0.15
210 0.12
211 0.12
212 0.11
213 0.11
214 0.11
215 0.09
216 0.12
217 0.11
218 0.12
219 0.12
220 0.11
221 0.14
222 0.14
223 0.16
224 0.13
225 0.14
226 0.13
227 0.15
228 0.16
229 0.14
230 0.13
231 0.16
232 0.18
233 0.17
234 0.18
235 0.2
236 0.2
237 0.2
238 0.22
239 0.21
240 0.2
241 0.24
242 0.29
243 0.29
244 0.28
245 0.29
246 0.29
247 0.26
248 0.28
249 0.28
250 0.25
251 0.23
252 0.26
253 0.25
254 0.23
255 0.22
256 0.17
257 0.15
258 0.13
259 0.13
260 0.09
261 0.1
262 0.09
263 0.09
264 0.09
265 0.07
266 0.06
267 0.06
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.06
274 0.07
275 0.09
276 0.09
277 0.09
278 0.09
279 0.1
280 0.11
281 0.12
282 0.12
283 0.11
284 0.12
285 0.12
286 0.12
287 0.12
288 0.1
289 0.09
290 0.1
291 0.09
292 0.09
293 0.11
294 0.12
295 0.13
296 0.14
297 0.14
298 0.14
299 0.13
300 0.15
301 0.13
302 0.13
303 0.14
304 0.15
305 0.15
306 0.15
307 0.16
308 0.14
309 0.13
310 0.12
311 0.11
312 0.09
313 0.09