Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WH55

Protein Details
Accession A0A1Y1WH55    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-115DNSLPTKQCKTCKHKFHRMCLFKWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039795  LTN1/Rkr1  
IPR039804  RING-CH-C4HC3_LTN1  
IPR001841  Znf_RING  
IPR011016  Znf_RING-CH  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005829  C:cytosol  
GO:1990112  C:RQC complex  
GO:0043023  F:ribosomal large subunit binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
GO:0072344  P:rescue of stalled ribosome  
GO:1990116  P:ribosome-associated ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16491  RING-CH-C4HC3_LTN1  
Amino Acid Sequences QVSMTYTVDDSTLEITVRVPASYPLSLPTIESMKRVAVTEKRWRSWLVAAQAQMSRNRRLDAVCAQLLGNVGAHFAGVEDCAICYSAVGALDNSLPTKQCKTCKHKFHRMCLFKWFSTSNQSSCPLCRNLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.12
4 0.12
5 0.11
6 0.1
7 0.12
8 0.16
9 0.16
10 0.16
11 0.15
12 0.16
13 0.16
14 0.16
15 0.16
16 0.16
17 0.16
18 0.16
19 0.16
20 0.15
21 0.16
22 0.16
23 0.19
24 0.21
25 0.27
26 0.37
27 0.42
28 0.43
29 0.44
30 0.45
31 0.42
32 0.41
33 0.4
34 0.34
35 0.3
36 0.29
37 0.29
38 0.3
39 0.29
40 0.3
41 0.28
42 0.27
43 0.26
44 0.26
45 0.25
46 0.23
47 0.25
48 0.23
49 0.24
50 0.19
51 0.18
52 0.17
53 0.17
54 0.16
55 0.13
56 0.1
57 0.05
58 0.05
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.07
82 0.08
83 0.1
84 0.16
85 0.21
86 0.3
87 0.39
88 0.47
89 0.57
90 0.67
91 0.74
92 0.8
93 0.83
94 0.85
95 0.86
96 0.84
97 0.77
98 0.76
99 0.73
100 0.62
101 0.59
102 0.51
103 0.43
104 0.45
105 0.47
106 0.39
107 0.37
108 0.41
109 0.38
110 0.39
111 0.42