Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VR31

Protein Details
Accession A0A1Y1VR31    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-30SKRQRISRACDRCRRKKVKCDGRRPICTHCBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences SKRQRISRACDRCRRKKVKCDGRRPICTHCQAIGSSCTYLDVTKKRGPPKGYIEAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.88
4 0.89
5 0.9
6 0.9
7 0.91
8 0.9
9 0.89
10 0.89
11 0.82
12 0.77
13 0.73
14 0.67
15 0.57
16 0.47
17 0.39
18 0.31
19 0.29
20 0.24
21 0.19
22 0.15
23 0.13
24 0.13
25 0.11
26 0.12
27 0.16
28 0.19
29 0.24
30 0.3
31 0.37
32 0.44
33 0.51
34 0.54
35 0.56
36 0.6