Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WHV1

Protein Details
Accession A0A1Y1WHV1   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-52RNTFIRLRQRKIREERENRRLRRERIBasic
NLS Segment(s)
PositionSequence
35-49QRKIREERENRRLRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004918  Cdc37  
IPR013855  Cdc37_N_dom  
Gene Ontology GO:0019901  F:protein kinase binding  
Pfam View protein in Pfam  
PF03234  CDC37_N  
Amino Acid Sequences MPIDYSKWDNLELSDDSDVEVHPNIERNTFIRLRQRKIREERENRRLRRERIETMIPMNKDLIERISALRSRIADANEDSLKEIMKEWAQDVEKARVAKEKRDSATSQGKIPEQPPRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.16
5 0.15
6 0.12
7 0.11
8 0.09
9 0.09
10 0.14
11 0.15
12 0.16
13 0.17
14 0.17
15 0.23
16 0.24
17 0.28
18 0.33
19 0.39
20 0.45
21 0.53
22 0.59
23 0.63
24 0.7
25 0.76
26 0.77
27 0.8
28 0.84
29 0.85
30 0.88
31 0.81
32 0.82
33 0.8
34 0.74
35 0.72
36 0.69
37 0.62
38 0.57
39 0.57
40 0.48
41 0.45
42 0.44
43 0.35
44 0.29
45 0.25
46 0.2
47 0.16
48 0.15
49 0.11
50 0.07
51 0.08
52 0.08
53 0.11
54 0.12
55 0.13
56 0.15
57 0.14
58 0.15
59 0.17
60 0.17
61 0.16
62 0.16
63 0.2
64 0.18
65 0.18
66 0.17
67 0.15
68 0.14
69 0.12
70 0.12
71 0.1
72 0.11
73 0.11
74 0.11
75 0.17
76 0.18
77 0.21
78 0.24
79 0.27
80 0.29
81 0.29
82 0.29
83 0.31
84 0.33
85 0.37
86 0.42
87 0.46
88 0.45
89 0.51
90 0.52
91 0.52
92 0.6
93 0.54
94 0.49
95 0.45
96 0.45
97 0.44
98 0.45
99 0.48