Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W4A2

Protein Details
Accession A0A1Y1W4A2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-53SRSKKRFSFWHKKQSRSKHKLKIPTTHydrophilic
NLS Segment(s)
PositionSequence
30-49SKKRFSFWHKKQSRSKHKLK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPSNTDDRPTSINPSGSWLDLSDGEDASRSKKRFSFWHKKQSRSKHKLKIPTTDKVKHDPLRFLKPTLKIGLFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.28
4 0.26
5 0.19
6 0.16
7 0.15
8 0.16
9 0.12
10 0.1
11 0.1
12 0.1
13 0.1
14 0.13
15 0.18
16 0.18
17 0.2
18 0.22
19 0.26
20 0.33
21 0.43
22 0.51
23 0.53
24 0.64
25 0.67
26 0.73
27 0.79
28 0.81
29 0.83
30 0.81
31 0.82
32 0.8
33 0.81
34 0.82
35 0.78
36 0.78
37 0.72
38 0.72
39 0.7
40 0.68
41 0.65
42 0.62
43 0.66
44 0.63
45 0.61
46 0.61
47 0.6
48 0.62
49 0.61
50 0.59
51 0.57
52 0.55
53 0.56
54 0.54