Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H0EG51

Protein Details
Accession H0EG51   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-27GSGSKPPKNDDKKPTPAPSPHydrophilic
NLS Segment(s)
PositionSequence
5-23KGGGSGSKPPKNDDKKPTP
129-131KSK
139-144VKSKRE
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MPKGKGGGSGSKPPKNDDKKPTPAPSPPKTPTPAPTPASTPPPAPKPTSAPPVPVTSPKVAPTSPAVSSEAVKSKPAETSDTKAASKGTTTSTSVSKSTSVSKPTATSDANEPTGVCKKIVGKRIGASKSKTGGDSAPVKSKREAKSPALGVTKTESRAKPTSGAATSPSKAGVPKFLDLEKASSIVLSKQSVRGTSIVVIASQMQVVAVTFKTSPGKKELTALVKEFDSKMKGNGPAKFKIAKSAKTFDVHVKKVEGSWPEIEIRAGATCHAVEYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.67
4 0.67
5 0.68
6 0.72
7 0.8
8 0.81
9 0.77
10 0.77
11 0.77
12 0.74
13 0.73
14 0.68
15 0.66
16 0.64
17 0.62
18 0.58
19 0.55
20 0.56
21 0.5
22 0.48
23 0.45
24 0.45
25 0.46
26 0.43
27 0.4
28 0.38
29 0.42
30 0.43
31 0.42
32 0.41
33 0.42
34 0.46
35 0.51
36 0.46
37 0.44
38 0.43
39 0.44
40 0.43
41 0.41
42 0.39
43 0.34
44 0.34
45 0.32
46 0.33
47 0.28
48 0.27
49 0.27
50 0.26
51 0.23
52 0.23
53 0.22
54 0.2
55 0.21
56 0.23
57 0.23
58 0.21
59 0.21
60 0.21
61 0.2
62 0.22
63 0.23
64 0.24
65 0.23
66 0.27
67 0.32
68 0.34
69 0.32
70 0.3
71 0.29
72 0.24
73 0.22
74 0.18
75 0.15
76 0.15
77 0.16
78 0.17
79 0.18
80 0.2
81 0.2
82 0.19
83 0.17
84 0.16
85 0.2
86 0.22
87 0.23
88 0.23
89 0.23
90 0.24
91 0.25
92 0.27
93 0.22
94 0.2
95 0.2
96 0.22
97 0.22
98 0.2
99 0.18
100 0.17
101 0.21
102 0.2
103 0.16
104 0.15
105 0.2
106 0.26
107 0.33
108 0.33
109 0.3
110 0.33
111 0.4
112 0.44
113 0.41
114 0.38
115 0.34
116 0.35
117 0.34
118 0.31
119 0.24
120 0.2
121 0.2
122 0.22
123 0.21
124 0.26
125 0.27
126 0.28
127 0.3
128 0.37
129 0.36
130 0.38
131 0.41
132 0.36
133 0.41
134 0.41
135 0.43
136 0.38
137 0.35
138 0.28
139 0.26
140 0.25
141 0.21
142 0.25
143 0.21
144 0.24
145 0.26
146 0.27
147 0.26
148 0.25
149 0.27
150 0.22
151 0.22
152 0.2
153 0.21
154 0.2
155 0.18
156 0.17
157 0.14
158 0.15
159 0.15
160 0.17
161 0.17
162 0.18
163 0.19
164 0.19
165 0.22
166 0.21
167 0.22
168 0.17
169 0.15
170 0.13
171 0.11
172 0.12
173 0.1
174 0.12
175 0.12
176 0.12
177 0.16
178 0.17
179 0.18
180 0.19
181 0.18
182 0.17
183 0.17
184 0.17
185 0.13
186 0.12
187 0.11
188 0.1
189 0.09
190 0.08
191 0.07
192 0.05
193 0.04
194 0.04
195 0.06
196 0.05
197 0.06
198 0.07
199 0.09
200 0.16
201 0.17
202 0.2
203 0.24
204 0.27
205 0.27
206 0.31
207 0.35
208 0.35
209 0.38
210 0.37
211 0.34
212 0.31
213 0.32
214 0.29
215 0.26
216 0.23
217 0.2
218 0.22
219 0.25
220 0.32
221 0.37
222 0.42
223 0.44
224 0.44
225 0.47
226 0.5
227 0.45
228 0.47
229 0.48
230 0.49
231 0.5
232 0.52
233 0.52
234 0.49
235 0.51
236 0.51
237 0.54
238 0.5
239 0.46
240 0.44
241 0.4
242 0.39
243 0.42
244 0.35
245 0.3
246 0.29
247 0.29
248 0.28
249 0.28
250 0.26
251 0.21
252 0.19
253 0.16
254 0.14
255 0.12
256 0.13
257 0.12