Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WER0

Protein Details
Accession A0A1Y1WER0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-90FVPANPWKKCSQRKSNTICKLFVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, extr 2, E.R. 2, cyto 1, pero 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSVSLYMAIFAAILVLIYRLIFWRLLGSEGRRRVVRYAKMHGVRDRLFFLNCTLYSTQSDVTITTPAFVPANPWKKCSQRKSNTICKLFVAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.05
7 0.06
8 0.07
9 0.07
10 0.09
11 0.09
12 0.11
13 0.14
14 0.18
15 0.24
16 0.28
17 0.31
18 0.3
19 0.31
20 0.34
21 0.39
22 0.43
23 0.4
24 0.43
25 0.48
26 0.51
27 0.54
28 0.52
29 0.5
30 0.44
31 0.4
32 0.37
33 0.3
34 0.25
35 0.21
36 0.2
37 0.17
38 0.16
39 0.17
40 0.15
41 0.15
42 0.16
43 0.17
44 0.16
45 0.13
46 0.13
47 0.1
48 0.11
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.09
56 0.13
57 0.2
58 0.3
59 0.31
60 0.34
61 0.39
62 0.49
63 0.59
64 0.64
65 0.66
66 0.67
67 0.76
68 0.82
69 0.87
70 0.87
71 0.82
72 0.74