Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VU20

Protein Details
Accession A0A1Y1VU20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-69SSGPKAQSRKGKGDRKKRTKGRCTRATPEECTHydrophilic
NLS Segment(s)
PositionSequence
42-58KAQSRKGKGDRKKRTKG
Subcellular Location(s) extr 13, mito 10, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQLALPGVFGNGPRSMVLAASVSAVSLVACALMLAAASSGPKAQSRKGKGDRKKRTKGRCTRATPEECT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.08
6 0.08
7 0.07
8 0.07
9 0.06
10 0.06
11 0.05
12 0.04
13 0.04
14 0.03
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.03
27 0.04
28 0.08
29 0.1
30 0.16
31 0.24
32 0.3
33 0.4
34 0.5
35 0.59
36 0.66
37 0.76
38 0.81
39 0.83
40 0.89
41 0.89
42 0.9
43 0.91
44 0.92
45 0.92
46 0.91
47 0.89
48 0.87
49 0.87