Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1W634

Protein Details
Accession A0A1Y1W634    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-44HGSLKLKKDSKLFKKKSKKSKKRHHKESKDSEPVVBasic
NLS Segment(s)
PositionSequence
14-36KLKKDSKLFKKKSKKSKKRHHKE
Subcellular Location(s) nucl 20.5, mito_nucl 13.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MSAYDNGVVHGSLKLKKDSKLFKKKSKKSKKRHHKESKDSEPVVQAVTQTEAERKFEQVQRKRQMERIEKMAAKSHSERVREFNNKLEQAPEHNEMPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.35
4 0.43
5 0.51
6 0.58
7 0.65
8 0.71
9 0.74
10 0.82
11 0.87
12 0.9
13 0.91
14 0.91
15 0.91
16 0.93
17 0.94
18 0.94
19 0.96
20 0.96
21 0.95
22 0.95
23 0.94
24 0.93
25 0.9
26 0.79
27 0.69
28 0.59
29 0.48
30 0.38
31 0.28
32 0.18
33 0.1
34 0.1
35 0.09
36 0.08
37 0.11
38 0.1
39 0.13
40 0.14
41 0.15
42 0.18
43 0.22
44 0.32
45 0.37
46 0.47
47 0.53
48 0.59
49 0.6
50 0.6
51 0.66
52 0.65
53 0.6
54 0.56
55 0.53
56 0.49
57 0.48
58 0.5
59 0.42
60 0.38
61 0.37
62 0.39
63 0.38
64 0.4
65 0.4
66 0.39
67 0.47
68 0.49
69 0.49
70 0.49
71 0.52
72 0.5
73 0.49
74 0.47
75 0.4
76 0.39
77 0.43
78 0.39
79 0.33
80 0.34
81 0.34
82 0.32