Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1W2M2

Protein Details
Accession A0A1Y1W2M2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-119HLTLDTTSRKQRKERKNRLKKLRGTAKVKGKKARKEBasic
NLS Segment(s)
PositionSequence
92-119RKQRKERKNRLKKLRGTAKVKGKKARKE
Subcellular Location(s) mito 20, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MTNRLLQRKQMVVDIIHPGLANISKEELREKLSKLYKSDKESIFVFGFRTQFGGGKTTGFALVYDSLDAAKKFEPKYRLARQGHLTLDTTSRKQRKERKNRLKKLRGTAKVKGKKARKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.24
4 0.22
5 0.18
6 0.17
7 0.17
8 0.15
9 0.1
10 0.13
11 0.13
12 0.14
13 0.17
14 0.17
15 0.2
16 0.22
17 0.23
18 0.29
19 0.35
20 0.38
21 0.4
22 0.47
23 0.49
24 0.52
25 0.57
26 0.5
27 0.46
28 0.43
29 0.42
30 0.34
31 0.28
32 0.23
33 0.19
34 0.18
35 0.15
36 0.15
37 0.12
38 0.12
39 0.13
40 0.13
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.07
48 0.06
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.13
59 0.14
60 0.2
61 0.23
62 0.27
63 0.37
64 0.43
65 0.52
66 0.5
67 0.54
68 0.53
69 0.55
70 0.51
71 0.44
72 0.38
73 0.29
74 0.31
75 0.29
76 0.29
77 0.33
78 0.37
79 0.4
80 0.48
81 0.58
82 0.64
83 0.72
84 0.8
85 0.82
86 0.88
87 0.93
88 0.95
89 0.95
90 0.93
91 0.92
92 0.91
93 0.9
94 0.86
95 0.84
96 0.84
97 0.83
98 0.83
99 0.82