Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1W0B6

Protein Details
Accession A0A1Y1W0B6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-30QYTEKEKRERKYECTHCKKRFTRPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MVTVQYTEKEKRERKYECTHCKKRFTRPSSLTSHVYTHTGEKPFACDFPNCTKRFSVLSNLRRHYKVHTHKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.75
4 0.76
5 0.8
6 0.83
7 0.81
8 0.86
9 0.84
10 0.84
11 0.84
12 0.79
13 0.78
14 0.73
15 0.71
16 0.67
17 0.65
18 0.58
19 0.49
20 0.44
21 0.34
22 0.3
23 0.25
24 0.21
25 0.21
26 0.19
27 0.18
28 0.17
29 0.19
30 0.19
31 0.19
32 0.18
33 0.15
34 0.18
35 0.28
36 0.37
37 0.34
38 0.36
39 0.35
40 0.36
41 0.38
42 0.36
43 0.36
44 0.37
45 0.45
46 0.52
47 0.57
48 0.6
49 0.59
50 0.58
51 0.56
52 0.57
53 0.59