Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WJQ3

Protein Details
Accession A0A1Y1WJQ3   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-132IRHDREKCNSIQRRRAHRQRSHHKKSSPMSDEBasic
NLS Segment(s)
PositionSequence
115-121RAHRQRS
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000232  HSF_DNA-bd  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00447  HSF_DNA-bind  
Amino Acid Sequences MDIYKLITLNQPFATFPQALYRILEEGHSWIEWNPDGTKIRYNDPERLMRELQALGFKAQDSASLSKNFNDYGFKRLSDARKSRYDPYRTSWTVFAHASFIRHDREKCNSIQRRRAHRQRSHHKKSSPMSDELIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.2
3 0.19
4 0.23
5 0.23
6 0.23
7 0.24
8 0.23
9 0.2
10 0.19
11 0.2
12 0.13
13 0.12
14 0.13
15 0.11
16 0.11
17 0.11
18 0.13
19 0.13
20 0.14
21 0.13
22 0.16
23 0.19
24 0.2
25 0.25
26 0.25
27 0.29
28 0.36
29 0.39
30 0.4
31 0.42
32 0.48
33 0.44
34 0.47
35 0.43
36 0.35
37 0.33
38 0.28
39 0.24
40 0.19
41 0.18
42 0.13
43 0.12
44 0.11
45 0.1
46 0.09
47 0.1
48 0.1
49 0.11
50 0.13
51 0.16
52 0.16
53 0.16
54 0.17
55 0.16
56 0.14
57 0.17
58 0.16
59 0.17
60 0.18
61 0.18
62 0.18
63 0.23
64 0.28
65 0.32
66 0.37
67 0.38
68 0.44
69 0.48
70 0.54
71 0.58
72 0.58
73 0.52
74 0.52
75 0.56
76 0.5
77 0.49
78 0.45
79 0.38
80 0.35
81 0.33
82 0.27
83 0.2
84 0.2
85 0.19
86 0.17
87 0.19
88 0.2
89 0.25
90 0.27
91 0.29
92 0.36
93 0.38
94 0.42
95 0.5
96 0.55
97 0.59
98 0.66
99 0.7
100 0.73
101 0.8
102 0.85
103 0.85
104 0.85
105 0.87
106 0.89
107 0.92
108 0.92
109 0.9
110 0.85
111 0.84
112 0.83
113 0.83
114 0.77
115 0.7