Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VZ83

Protein Details
Accession A0A1Y1VZ83   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
136-162YLPAKKFAKTIDRRKHRELRSRAGPGCHydrophilic
NLS Segment(s)
PositionSequence
145-155TIDRRKHRELR
Subcellular Location(s) cyto 14, mito 6, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
Amino Acid Sequences MALRCSVLESAVGSMWTLTRGVEGCVPVTGPHIEGLVQICEFAPTSDLRVRAVGALGNIARRQPGFVDLNRRIGAYLLENVIVKPLLQPTKDPAAIAEPIVEALDLFFDIYSDMAYDYDEPVFVKGEFLARLRQVYLPAKKFAKTIDRRKHRELRSRAGPGCPESPGIPRLQGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.06
6 0.08
7 0.09
8 0.1
9 0.13
10 0.13
11 0.13
12 0.13
13 0.13
14 0.12
15 0.14
16 0.13
17 0.11
18 0.1
19 0.1
20 0.1
21 0.11
22 0.12
23 0.11
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.08
31 0.07
32 0.11
33 0.14
34 0.15
35 0.15
36 0.15
37 0.15
38 0.14
39 0.14
40 0.11
41 0.08
42 0.1
43 0.09
44 0.11
45 0.11
46 0.11
47 0.11
48 0.1
49 0.11
50 0.09
51 0.14
52 0.16
53 0.18
54 0.27
55 0.28
56 0.33
57 0.32
58 0.31
59 0.27
60 0.23
61 0.22
62 0.14
63 0.13
64 0.08
65 0.09
66 0.09
67 0.08
68 0.09
69 0.08
70 0.06
71 0.06
72 0.09
73 0.11
74 0.11
75 0.12
76 0.15
77 0.19
78 0.19
79 0.19
80 0.15
81 0.15
82 0.15
83 0.15
84 0.12
85 0.07
86 0.07
87 0.07
88 0.06
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.02
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.08
110 0.07
111 0.07
112 0.07
113 0.09
114 0.1
115 0.11
116 0.15
117 0.15
118 0.16
119 0.17
120 0.18
121 0.22
122 0.29
123 0.36
124 0.36
125 0.41
126 0.42
127 0.42
128 0.42
129 0.42
130 0.44
131 0.46
132 0.53
133 0.58
134 0.66
135 0.73
136 0.81
137 0.86
138 0.85
139 0.85
140 0.83
141 0.82
142 0.81
143 0.83
144 0.76
145 0.72
146 0.67
147 0.61
148 0.55
149 0.46
150 0.39
151 0.31
152 0.33
153 0.3
154 0.28