Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WHS6

Protein Details
Accession A0A1Y1WHS6    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
80-106GSLAARHRKYPRCSHRIRRTTARWSTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
Pfam View protein in Pfam  
PF01636  APH  
Amino Acid Sequences MPGSPQQRTAQRRNSSWAGLVTHAVKSLAAGWKRMVEMPFTLAHNDLEPRNILINKGKIVCVIDWENAEFYPPYCESSPGSLAARHRKYPRCSHRIRRTTARWSTLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.53
4 0.46
5 0.38
6 0.31
7 0.3
8 0.24
9 0.2
10 0.19
11 0.16
12 0.12
13 0.11
14 0.13
15 0.17
16 0.17
17 0.18
18 0.18
19 0.2
20 0.21
21 0.23
22 0.2
23 0.15
24 0.15
25 0.15
26 0.16
27 0.15
28 0.15
29 0.13
30 0.13
31 0.12
32 0.13
33 0.11
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.14
41 0.15
42 0.17
43 0.17
44 0.16
45 0.15
46 0.16
47 0.14
48 0.14
49 0.14
50 0.13
51 0.13
52 0.14
53 0.14
54 0.12
55 0.13
56 0.1
57 0.08
58 0.11
59 0.11
60 0.14
61 0.14
62 0.16
63 0.16
64 0.19
65 0.21
66 0.19
67 0.2
68 0.2
69 0.25
70 0.34
71 0.37
72 0.41
73 0.48
74 0.55
75 0.61
76 0.69
77 0.74
78 0.74
79 0.79
80 0.83
81 0.86
82 0.87
83 0.87
84 0.87
85 0.84
86 0.85
87 0.83