Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1W0P0

Protein Details
Accession A0A1Y1W0P0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-37FAAKKHFDKKKREEKLEQQEEIBasic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7, extr 7
Family & Domain DBs
Amino Acid Sequences MGKVLLAGAAVAAAGFAAKKHFDKKKREEKLEQQEEIGQGSYNYQYGGAQPPQGGYGATPTPGGKPHGNPNDPYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.03
4 0.05
5 0.08
6 0.1
7 0.19
8 0.28
9 0.37
10 0.47
11 0.58
12 0.67
13 0.74
14 0.79
15 0.79
16 0.81
17 0.84
18 0.81
19 0.71
20 0.61
21 0.53
22 0.45
23 0.37
24 0.27
25 0.16
26 0.08
27 0.08
28 0.08
29 0.06
30 0.06
31 0.05
32 0.05
33 0.07
34 0.11
35 0.11
36 0.12
37 0.12
38 0.12
39 0.13
40 0.13
41 0.12
42 0.07
43 0.1
44 0.1
45 0.1
46 0.11
47 0.11
48 0.12
49 0.15
50 0.2
51 0.2
52 0.24
53 0.34
54 0.43
55 0.46
56 0.48