Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1W2I3

Protein Details
Accession A0A1Y1W2I3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-63AKKVLKTVKKAAKHRHVKRGVKEVBasic
NLS Segment(s)
PositionSequence
37-71KKLAKKVLKTVKKAAKHRHVKRGVKEVVKGLRKGE
Subcellular Location(s) cyto 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences MGKSHKKEHTSAVVDTAADESAAPGILAPIAHPLADKKLAKKVLKTVKKAAKHRHVKRGVKEVVKGLRKGEKGLVVMAGNISPMDVLSHIPILCEDSNVPYCFVPTKEELGGSCSTKRPTCCIMIVPGGKGGKGEAHEDYKDSYDECFAAAKELDDKLLETAAAGVIQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.26
4 0.16
5 0.12
6 0.1
7 0.07
8 0.06
9 0.06
10 0.05
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.08
17 0.08
18 0.08
19 0.09
20 0.1
21 0.13
22 0.21
23 0.23
24 0.23
25 0.31
26 0.39
27 0.41
28 0.44
29 0.49
30 0.53
31 0.59
32 0.62
33 0.63
34 0.64
35 0.69
36 0.75
37 0.76
38 0.76
39 0.78
40 0.81
41 0.82
42 0.84
43 0.83
44 0.8
45 0.8
46 0.76
47 0.69
48 0.63
49 0.58
50 0.56
51 0.53
52 0.47
53 0.4
54 0.4
55 0.37
56 0.36
57 0.32
58 0.26
59 0.22
60 0.22
61 0.2
62 0.13
63 0.13
64 0.11
65 0.09
66 0.06
67 0.05
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.05
76 0.05
77 0.06
78 0.06
79 0.09
80 0.08
81 0.08
82 0.08
83 0.1
84 0.13
85 0.14
86 0.15
87 0.12
88 0.13
89 0.14
90 0.14
91 0.14
92 0.13
93 0.15
94 0.14
95 0.15
96 0.15
97 0.17
98 0.18
99 0.17
100 0.17
101 0.18
102 0.21
103 0.24
104 0.25
105 0.26
106 0.28
107 0.29
108 0.29
109 0.28
110 0.27
111 0.31
112 0.31
113 0.27
114 0.28
115 0.24
116 0.23
117 0.21
118 0.18
119 0.14
120 0.14
121 0.16
122 0.15
123 0.19
124 0.2
125 0.21
126 0.23
127 0.22
128 0.21
129 0.19
130 0.16
131 0.14
132 0.13
133 0.13
134 0.13
135 0.11
136 0.13
137 0.13
138 0.13
139 0.15
140 0.15
141 0.15
142 0.14
143 0.15
144 0.13
145 0.13
146 0.12
147 0.09
148 0.09
149 0.08