Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VVW0

Protein Details
Accession A0A1Y1VVW0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-42IHACAKPDPHKPKNHQPPGPBasic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 1, cyto 1, pero 1, E.R. 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLVTTLYAVSAAATAFVFGVIIHACAKPDPHKPKNHQPPGPLPIPQNAVSGHPQYTSNAGLSGYLHVEPPANAAVVSIPTSLSWQHQNSAEKKNPLTPYSLQSNLLMPTCSIIAPPPRIYTPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.06
8 0.05
9 0.06
10 0.08
11 0.08
12 0.09
13 0.09
14 0.13
15 0.16
16 0.26
17 0.35
18 0.42
19 0.51
20 0.59
21 0.69
22 0.78
23 0.83
24 0.77
25 0.72
26 0.73
27 0.69
28 0.63
29 0.55
30 0.45
31 0.38
32 0.38
33 0.33
34 0.27
35 0.22
36 0.21
37 0.21
38 0.21
39 0.18
40 0.15
41 0.14
42 0.13
43 0.15
44 0.13
45 0.11
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.06
66 0.05
67 0.05
68 0.06
69 0.07
70 0.09
71 0.14
72 0.14
73 0.17
74 0.22
75 0.29
76 0.33
77 0.41
78 0.45
79 0.44
80 0.45
81 0.49
82 0.49
83 0.43
84 0.43
85 0.38
86 0.37
87 0.38
88 0.39
89 0.33
90 0.3
91 0.31
92 0.28
93 0.26
94 0.22
95 0.15
96 0.14
97 0.14
98 0.12
99 0.11
100 0.13
101 0.19
102 0.24
103 0.27
104 0.29