Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WKI7

Protein Details
Accession A0A1Y1WKI7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-34SFGRRHTKTHSLCKRCGRRAFHNQKKTCHydrophilic
NLS Segment(s)
PositionSequence
53-57AKRRK
Subcellular Location(s) mito_nucl 10.833, mito 10, nucl 9.5, cyto_nucl 8.666, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTTSFGRRHTKTHSLCKRCGRRAFHNQKKTCASCGYPSAKIRSYNWGMKAKRRKTTGSGRMRYLKTVNNRFKNGFREGVKAAKSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.7
4 0.67
5 0.73
6 0.79
7 0.81
8 0.8
9 0.8
10 0.77
11 0.76
12 0.8
13 0.84
14 0.84
15 0.84
16 0.78
17 0.77
18 0.77
19 0.69
20 0.61
21 0.53
22 0.44
23 0.37
24 0.4
25 0.37
26 0.34
27 0.34
28 0.34
29 0.34
30 0.34
31 0.32
32 0.32
33 0.33
34 0.33
35 0.36
36 0.41
37 0.4
38 0.47
39 0.56
40 0.57
41 0.59
42 0.59
43 0.57
44 0.56
45 0.65
46 0.66
47 0.67
48 0.64
49 0.63
50 0.67
51 0.64
52 0.61
53 0.54
54 0.5
55 0.5
56 0.56
57 0.6
58 0.6
59 0.64
60 0.64
61 0.67
62 0.66
63 0.61
64 0.58
65 0.5
66 0.47
67 0.46
68 0.49