Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VWP0

Protein Details
Accession A0A1Y1VWP0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYARTKVPQLKSRKLPTRKELASHydrophilic
122-143APPSCPPCFRRRRNPASAAPSCHydrophilic
NLS Segment(s)
PositionSequence
57-67KGDEKRGGEGR
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 6
Family & Domain DBs
Amino Acid Sequences MYARTKVPQLKSRKLPTRKELASQKSSVEHQTCHRPACTARSIKRWPLHTSKTSTKKGDEKRGGEGRKMYRDIKSSNINWEEKKAEKRTETTGIQGGRPKKDGHIRQVLFDTWSIFSFTPFAPPSCPPCFRRRRNPASAAPSCRNCGKLCEGGGGRTRPEGVMRQGDRPRHHLFSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.83
4 0.84
5 0.77
6 0.76
7 0.75
8 0.73
9 0.7
10 0.62
11 0.57
12 0.5
13 0.49
14 0.48
15 0.41
16 0.35
17 0.34
18 0.43
19 0.44
20 0.44
21 0.42
22 0.37
23 0.37
24 0.41
25 0.44
26 0.43
27 0.44
28 0.5
29 0.55
30 0.61
31 0.64
32 0.62
33 0.6
34 0.59
35 0.62
36 0.58
37 0.59
38 0.61
39 0.64
40 0.66
41 0.63
42 0.59
43 0.61
44 0.63
45 0.67
46 0.65
47 0.59
48 0.6
49 0.66
50 0.62
51 0.56
52 0.54
53 0.49
54 0.47
55 0.48
56 0.42
57 0.37
58 0.4
59 0.38
60 0.36
61 0.37
62 0.32
63 0.36
64 0.38
65 0.37
66 0.33
67 0.34
68 0.33
69 0.3
70 0.36
71 0.33
72 0.33
73 0.32
74 0.34
75 0.35
76 0.38
77 0.34
78 0.29
79 0.29
80 0.26
81 0.25
82 0.28
83 0.27
84 0.24
85 0.26
86 0.24
87 0.25
88 0.33
89 0.36
90 0.39
91 0.45
92 0.44
93 0.44
94 0.45
95 0.41
96 0.33
97 0.28
98 0.22
99 0.13
100 0.13
101 0.13
102 0.11
103 0.11
104 0.12
105 0.11
106 0.14
107 0.15
108 0.15
109 0.16
110 0.18
111 0.24
112 0.28
113 0.34
114 0.33
115 0.42
116 0.52
117 0.59
118 0.67
119 0.72
120 0.75
121 0.79
122 0.83
123 0.81
124 0.8
125 0.79
126 0.76
127 0.72
128 0.66
129 0.6
130 0.55
131 0.5
132 0.41
133 0.38
134 0.36
135 0.34
136 0.32
137 0.36
138 0.34
139 0.36
140 0.41
141 0.39
142 0.35
143 0.31
144 0.31
145 0.25
146 0.27
147 0.28
148 0.27
149 0.35
150 0.36
151 0.43
152 0.49
153 0.57
154 0.58
155 0.6
156 0.6