Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VWJ4

Protein Details
Accession A0A1Y1VWJ4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-49ERNRIAALKCRQRKKQQLNELQQRHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences KASRRSESVDPKGGEDEKRKQFLERNRIAALKCRQRKKQQLNELQQRHDYMVYENERLKNEYLQLRDKALHIKTLLEAHRECAVAQANGVFGIDSLPPGTPNIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.48
4 0.48
5 0.52
6 0.51
7 0.5
8 0.54
9 0.58
10 0.61
11 0.57
12 0.54
13 0.52
14 0.54
15 0.51
16 0.52
17 0.51
18 0.5
19 0.52
20 0.56
21 0.62
22 0.69
23 0.8
24 0.82
25 0.83
26 0.83
27 0.85
28 0.87
29 0.89
30 0.83
31 0.74
32 0.65
33 0.56
34 0.46
35 0.36
36 0.26
37 0.17
38 0.19
39 0.18
40 0.19
41 0.2
42 0.22
43 0.22
44 0.23
45 0.23
46 0.18
47 0.2
48 0.23
49 0.24
50 0.27
51 0.27
52 0.27
53 0.27
54 0.27
55 0.3
56 0.26
57 0.26
58 0.21
59 0.21
60 0.2
61 0.26
62 0.26
63 0.24
64 0.24
65 0.23
66 0.25
67 0.25
68 0.23
69 0.21
70 0.22
71 0.17
72 0.17
73 0.15
74 0.13
75 0.12
76 0.12
77 0.08
78 0.05
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08